Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.17
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Synonym

Accession C9J302
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

 Compartment GO Term (0)

AA Sequence

MSHYFYLTPQILLPFSPLTSQEFDLIRRKAGASWQDETRWSDSSVTTYTGSYRKKQLDKSMCSQFSFRAG      1 - 70
QHEPECKQMSLTNSSACHLLCWAGTQETTDIKGLFPDITRPFKKSFDVKHGVAHQIWDFGDCFPTPPNYG     71 - 140
KYCVRPKKPAQEALINYSRRGKGVLKHLHGRCDSESKVCSSEDSEADRYSDYGWGGPSSPFN            141 - 202
//

Text Mined References (2)

PMID Year Title