Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.17
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Synonym

Accession C9J302
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MSHYFYLTPQILLPFSPLTSQEFDLIRRKAGASWQDETRWSDSSVTTYTGSYRKKQLDKSMCSQFSFRAG      1 - 70
QHEPECKQMSLTNSSACHLLCWAGTQETTDIKGLFPDITRPFKKSFDVKHGVAHQIWDFGDCFPTPPNYG     71 - 140
KYCVRPKKPAQEALINYSRRGKGVLKHLHGRCDSESKVCSSEDSEADRYSDYGWGGPSSPFN            141 - 202
//

Text Mined References (1)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.