Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession C9J202
Symbols

Gene

PANTHER Protein Class (2)

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MGATAGWAVTVYDKPASFFKEAPLDLQHRLFMKLGSTHSPFRARSEPEDPDTERSAFTERDSGSGLVTRL      1 - 70
HERPALLVSSTSWTEFEQLTLDGQNLPSLVCVITGKGPLREYYSRLIHQKHFQHIQVCIPWLEGRGLPPL     71 - 140
LGSVDLDVCLDTSSSGLDLPMKVVDMFRCCLPACAVNFKCLHELVKHEENRLVFEDSEELAAQLQYFADA    141 - 210
FLKLS                                                                     211 - 215
//

Text Mined References (2)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.