Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 1.1e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Endometrial cancer 311 0.0 0.6

AA Sequence

MNSGISQVFQRELTCPICLNYFIDPVTIDCGHSFCRPCFYLNWQDIPILTQCFECLKTTQQRNLKTNIRL      1 - 70
KKMASRARKASLWLFLSSEEQMCGTHRETKKIFCEVDRSLLCLLCSSSLEHRYHRHCPAEWAAEEHREKL     71 - 140
LKKMQSLWEKVCENQRNLNVETTRISHWKDYVNVRLEAIRAEYQKMPAFHHEEEKHNLEMLKKKGKDIFH    141 - 210
RLHLSKAKMAHRREILRGTYAELMKMCHKPDVELLQAFGDILHRSESVLLHMPQPLNLELRAGPITGLRD    211 - 280
RLNQFRVDITLPHNEANSHIFRRGDLRSICIGCDRQNAPHITATPTSFLAWGAQTFTSGKYYWEVHVGDS    281 - 350
WNWAFGVCNKYWKGTNQNGNIHGEEGLFSLGCVKNDIQCSLFTTSPLTLQYVPRPTNHVGLFLDCEARTV    351 - 420
SFVDVNQSSPIHTIPNCSFSPPLRPIFCCVHL                                          421 - 452
//

Text Mined References (2)

PMID Year Title