Property Summary

NCBI Gene PubMed Count 65
PubMed Score 71.03
PubTator Score 336.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.531 3.9e-02
psoriasis 1.200 1.1e-06

Protein-protein Interaction (3)

Gene RIF (33)

PMID Text
26767664 Patients with advanced atrophic AMD carried these rare variants more frequently than patients with neovascular AMD (11 of 93 [11.8%] vs 40 of 835 [4.8%]; P = .04).
26404905 Serum-expressed apolipoprotein B-100 protein, C9 Complement, and gelsolin can be used for differential diagnosis of Barrertts esophagus and adenocarcinoma of esophagus.
25735751 Complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis.
24719326 Data indicate that complement C9 binds to the ATPase domain of mortalin.
23943762 Borrelial CspA binds the human terminal complement components C7 and C9 and blocks assembly and membrane insertion of the terminal complement complex (TCC).
23487461 Liver biopsy specimens from chronically hepatitis C virus-infected patients exhibited a lower level of C9 mRNA expression than liver biopsy specimens from unrelated disease or healthy control human liver RNA.
22528500 Caveolin-1 and dynamin-2 are essential for removal of the complement C5b-9 complex via endocytosis.
22190594 the haploinsufficiency of C9, a terminal complement complex component, engenders reduced intraocular secretion of VEGF and decreased risk for CNV development.
21840429 C9 and fucosylated form could serve as a useful marker for SQLC.
21507937 Mapping the intermedilysin-human CD59 receptor interface reveals a deep correspondence with the binding site on CD59 for complement binding proteins C8alpha and C9.
21380615 It was concluded that variations in the complement component 9 gene are unlikely to influence clearance of chronic hepatitis B virus infection and hepatocellular carcinoma occurrence.
21057849 These results suggested that the lack of membrane attack complex because of an Arg95Stop mutation of the complement component 9 gene predisposed patients to pathognomonic glomerulonephritis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20153530 provided evidence for the recognition of membrane-bound C9 on complement-lysed ghosts by an antibody specific for the helix-turn-helix fold.
20139276 Data show that C1q, C4, C3, and C9 bind to thrombin receptor-activating peptide-activated platelets in lepirudin-anticoagulated platelet-rich plasma (PRP) and whole blood.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19864026 Complement C5b-9 induce a JNK/Bid-dependent and JNK-independent necrotic cell death.
19739077 Data show that mortalin supports cancer cell resistance to complement-dependent cytotoxicity and suggest consideration of mortalin as a novel target for cancer adjuvant immunotherapy.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19344414 Observational study of gene-disease association. (HuGE Navigator)
19162005 Cell cycle induction by C5b-9 in aortic endothelial cells is RGC-32 dependent and this is in part through regulation of Akt and growth factor release.
18842294 Observational study of gene-disease association. (HuGE Navigator)
17644516 the amount of C5b-9-AF488 bound to K562 cells after complement activation was highly heterogeneous and inversely correlated with the CD59 level of expression
17482181 Impairment of the mechanisms involved in the regulation of activation of complement system factors C5b-9 may be important in the pathogenesis of endometriosis and endometriosis-associated infertility.
16844690 analysis of the CD59-C9 binding interaction
16618117 results indicate that the principal binding site for C9 lies within the MACPF domain of C8alpha
12596049 Founder effect was demonstrated for the R95X mutation of the C9 gene in Japanese
12463754 C9 binding is dependent on the N-terminal modules (thrombospondin type 1 and low-density lipoprotein receptor class A) of C8 alpha together with the C8 alpha membrane attack complex/perforin domain.
11881818 The human complement C9 gene: structural analysis of the 5' gene region and genetic polymorphism studies.
8630395 A synthetic peptide covering positions 233-251 of the HIV-1 gp120 protein binds to complement proteins C3, C4, C5, C9, and properdin

AA Sequence

MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVF      1 - 70
GQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRP     71 - 140
PCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEK    141 - 210
NFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETY    211 - 280
QLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSG    281 - 350
SLGGLYELIYVLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSEN    351 - 420
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLK    421 - 490
KQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK     491 - 559
//

Text Mined References (70)

PMID Year Title
26767664 2016 Rare Genetic Variants Associated With Development of Age-Related Macular Degeneration.
26404905 2015 Serum Glycoprotein Biomarker Discovery and Qualification Pipeline Reveals Novel Diagnostic Biomarker Candidates for Esophageal Adenocarcinoma.
25735751 2015 Exposure to the complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis.
24719326 2014 Mortalin/GRP75 binds to complement C9 and plays a role in resistance to complement-dependent cytotoxicity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24036952 2013 Rare variants in CFI, C3 and C9 are associated with high risk of advanced age-related macular degeneration.
23943762 2013 CspA from Borrelia burgdorferi inhibits the terminal complement pathway.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23487461 2013 Hepatitis C virus suppresses C9 complement synthesis and impairs membrane attack complex function.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22528500 2012 Caveolin-1 and dynamin-2 are essential for removal of the complement C5b-9 complex via endocytosis.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22190594 2012 C9-R95X polymorphism in patients with neovascular age-related macular degeneration.
21840429 2011 Fucosylated glycoproteomic approach to identify a complement component 9 associated with squamous cell lung cancer (SQLC).
21507937 2011 Mapping the intermedilysin-human CD59 receptor interface reveals a deep correspondence with the binding site on CD59 for complement binding proteins C8alpha and C9.
21380615 2011 Genetic analysis of complement component 9 (C9) polymorphisms with clearance of hepatitis B virus infection.
21057849 2011 Membranoproliferative pattern of glomerular injury associated with complement component 9 deficiency due to Arg95Stop mutation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20153530 2010 Topology of the membrane-bound form of complement protein C9 probed by glycosylation mapping, anti-peptide antibody binding, and disulfide modification.
20139276 2010 Complement component C3 binds to activated normal platelets without preceding proteolytic activation and promotes binding to complement receptor 1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19864026 2009 Involvement of the c-jun N-terminal kinases JNK1 and JNK2 in complement-mediated cell death.
19739077 2010 Mortalin inhibitors sensitize K562 leukemia cells to complement-dependent cytotoxicity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19162005 2009 Response gene to complement 32 is required for C5b-9 induced cell cycle activation in endothelial cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17644516 2007 Live cell imaging of outward and inward vesiculation induced by the complement c5b-9 complex.
17482181 2007 Levels of complement components iC3b, C3c, C4, and SC5b-9 in peritoneal fluid and serum of infertile women with endometriosis.
16844690 2006 Defining the CD59-C9 binding interaction.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16618117 2006 Functional studies of the MACPF domain of human complement protein C8alpha reveal sites for simultaneous binding of C8beta, C8gamma, and C9.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
12596049 2003 Founder effect of the C9 R95X mutation in Orientals.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12463754 2002 Binding of human complement C8 to C9: role of the N-terminal modules in the C8 alpha subunit.
11359403 2001 Hereditary complement (C9) deficiency associated with dermatomyositis.
11027207 2000 Deficiency of complement defense protein CD59 may contribute to neurodegeneration in Alzheimer's disease.
10551839 1999 The four terminal components of the complement system are C-mannosylated on multiple tryptophan residues.
9703418 1998 Nonsense mutation in exon 4 of human complement C9 gene is the major cause of Japanese complement C9 deficiency.
9634479 1998 Heterogeneity in the genetic basis of human complement C9 deficiency.
9570574 1998 A non-sense mutation at Arg95 is predominant in complement 9 deficiency in Japanese.
9144525 1997 The human complement C9 gene: identification of two mutations causing deficiency and revision of the gene structure.
8603752 1996 Identification of disulfide bonds in the ninth component (C9) of human complement.
8471847 1993 The expression of hemolytically active human complement protein C9 in mammalian, insect, and yeast cells.
8345200 1993 Clusterin, the human apolipoprotein and complement inhibitor, binds to complement C7, C8 beta, and the b domain of C9.
7523406 1994 Identity of a peptide domain of human C9 that is bound by the cell-surface complement inhibitor, CD59.
6095282 1984 Nucleotide sequence of cDNA and derived amino acid sequence of human complement component C9.
4063341 1985 Analysis of the specific association of the eighth and ninth components of human complement: identification of a direct role for the alpha subunit of C8.
4055801 1985 The architecture of complement component C9 and poly(C9).
4018030 1985 The sequence and topology of human complement component C9.
3624872 1987 Evidence that C5b recognizes and mediates C8 incorporation into the cytolytic complex of complement.
3219351 1988 Relationships between the gene and protein structure in human complement component C9.
2744767 1989 The gene for human complement component C9 mapped to chromosome 5 by polymerase chain reaction.
2426252 1986 The ninth component of human complement (C9). Functional activity of the b fragment.
2395434 1990 Localization and molecular modelling of the membrane-inserted domain of the ninth component of human complement and perforin.
1672663 1991 DNA polymorphisms and linkage relationship of the human complement component C6, C7, and C9 genes.
1377690 1992 The human complement regulatory protein CD59 binds to the alpha-chain of C8 and to the "b"domain of C9.