Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 8.3e-03
ovarian cancer 1.900 2.0e-05
pancreatic ductal adenocarcinoma liver m... -1.297 1.2e-02
tuberculosis 2.300 5.9e-11

 Compartment GO Term (1)

AA Sequence

MWPPCGTLRTLALARSRGARACSGDGGVSYTQGQSPEPRTREYFYYVDHQGQLFLDDSKMKNFITCFKDP      1 - 70
QFLVTFFSRLRPNRSGRYEAAFPFLSPCGRERNFLRCEDRPVVFTHLLTADHGPPRLSYCGGGEALAVPF     71 - 140
EPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEYGPGAPALPSHVRWQGRRLALTMDLAPLL    141 - 210
LAARSP                                                                    211 - 216
//

Text Mined References (3)

PMID Year Title