Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary


No data available


  Disease (1)


  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 2.600 1.5e-10
group 3 medulloblastoma 1.800 2.5e-04
pilocytic astrocytoma 1.300 1.7e-05

AA Sequence

TEQKLQRDGNSACHLPFSLPFLKRLTLIKPELVIVNDNV                                   281 - 319

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19060904 2009 An empirical framework for binary interactome mapping.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.