Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 9.4e-07
Astrocytoma, Pilocytic 3081 2.5e-05
group 3 medulloblastoma 4104 2.5e-04
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 2.5e-05
ependymoma 1.700 9.4e-07
group 3 medulloblastoma 1.800 2.5e-04

AA Sequence

MAICPELAQTDKSALANLSDETETLKNSTDEVQTSSSFSSSGGRQSSPLTSGSKLEREKQTPSLEQGDTQ      1 - 70
SELLDYKNYEKKLSKKWINYLKLKDSNFERHQPDTKLPTEITRVSDEELNALQSYCTMKINLIHRRGDSK     71 - 140
KKTSSRHKKLHLGLDVEASERDAFSCTVPDELLNRIYFKNMRTTPKQEAAAKQHISYQCPYCNRKRAELA    141 - 210
LSAFLKQKKTLLESFLLQERIDEHLHTKDFLTRIGEAHQDFPRLSDDPRIIWKRLTEKSHIRYSGFERSE    211 - 280
TEQKLQRDGNSACHLPFSLPFLKRLTLIKPELVIVNDNV                                   281 - 319
//

Text Mined References (8)

PMID Year Title