Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma -2.200 2.1e-02
ependymoma -3.100 2.3e-09
sonic hedgehog group medulloblastoma -4.400 1.3e-07
atypical teratoid / rhabdoid tumor -4.700 3.4e-08
medulloblastoma, large-cell -5.300 1.1e-05
primitive neuroectodermal tumor -2.500 1.6e-02
pediatric high grade glioma -1.700 2.3e-02
non primary Sjogren syndrome sicca -1.200 1.9e-02
subependymal giant cell astrocytoma -2.691 2.9e-02
Alzheimer's disease -1.500 2.6e-02
Pick disease -1.900 3.0e-05
psoriasis -1.300 1.8e-32

AA Sequence

MMHQIYSCSDENIEVFTTVIPSKVSSPARRRAKSSQHLLTKNVVIESDLYTHQPLELLPHRGDRRDPGDR      1 - 70
RRFGRLQTARPPTAHPAKASARPVGISEPKTSNLCGNRAYGKSLIPPVPRISVKTSASASLEATAMGTEK     71 - 140
GAVLMRGSRHLKKMTEEYPALPQGAEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATNSAFEAD       141 - 207
//

Text Mined References (4)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.