Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 4.7e-10
malignant mesothelioma 3232 6.7e-07

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.200 4.7e-10
malignant mesothelioma 2.500 6.7e-07

Synonym

Accession Q96CB5 Q9NUM6
Symbols

Gene

  Ortholog (1)

Species Source Disease
OMA EggNOG

AA Sequence

MRKNESYLNQPAPPIPIPTLSLMGGCREHFENHWKGRARWLMPVIPALWEAKAGRSPEVRSSKPAWPTWR      1 - 70
NPIFTKNTKISQVLELFLNYQSLICALEKQKRQKGSLAIFCWSFQGGCVSKRPDVPSLKSQKPKRKRITG     71 - 140
RKRLSKGFWSLLFSNLGRF                                                       141 - 159
//

Text Mined References (5)

PMID Year Title