Property Summary

NCBI Gene PubMed Count 24
PubMed Score 9.80
PubTator Score 44.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
oligodendroglioma -1.700 2.1e-02
Barrett's esophagus 1.900 3.3e-02
esophageal adenocarcinoma 1.600 2.8e-02
cutaneous lupus erythematosus 1.300 1.3e-02
astrocytoma 1.100 5.2e-04
glioblastoma 3.800 1.1e-03
group 4 medulloblastoma -2.300 2.1e-03
atypical teratoid / rhabdoid tumor -1.500 1.1e-02
medulloblastoma, large-cell -2.300 7.4e-03
adrenocortical adenoma -1.211 6.5e-03
adrenocortical carcinoma -1.262 4.9e-02
non-small cell lung cancer -1.898 8.0e-12
lung cancer -3.400 5.4e-06
colon cancer -2.200 4.1e-02
aldosterone-producing adenoma -1.357 2.0e-02
psoriasis -2.100 4.7e-08
inflammatory breast cancer -2.800 1.7e-04
lung carcinoma -2.600 3.9e-20
gastric carcinoma 1.300 4.1e-02
ductal carcinoma in situ 2.000 4.1e-02
ulcerative colitis 2.800 6.8e-06
ovarian cancer 3.000 1.2e-03
pituitary cancer -1.500 2.7e-04

 GO Function (1)

Gene RIF (16)

PMID Text
26744410 Decreased capacity of fibrotic lung fibroblasts to up-regulate COX-2 expression and COX-2-derived PGE2 synthesis is due to an indirect epigenetic mechanism involving hypermethylation of the transcriptional regulator, c8orf4.
25985737 C8orf4 negatively regulates the self-renewal of liver CSCs via suppression of NOTCH2 signalling
25869879 the high expression of TC1 was common in oral tongue squamous cell carcinomas and correlated with the expression of b-catenin and cyclin D1 and the progression of oral tongue squamous cell carcinomas
24941347 TC-1 overexpression promotes cell proliferation in human non-small cell lung cancer that can be inhibited by PD173074.
23880650 TC-1 expression is associated with aggressive biologic behavior in lung cancer and might coordinate with the Wnt/beta-catenin pathway as a positive upstream regulator that induces these behaviors.
23377761 The higher expression of TC-1 in ovarian compared to colorectal adenocarcinomas suggests its potential use as a marker
22658654 The SNP rs10958605 in the C8orf4 gene had the smallest p value in analyses of the motor outcome.
20878554 A significant association was found between the copy-number deletions of C8orf4 and the risk of hematological malignancies.
18959821 TC1 was involved in the mitogen-activated ERK1/2 signaling pathway and positively regulated G(1)- to S-phase transition of the cell cycle.
17905836 intrinsically disordered TC-1 interacts with Cby via its transient helical structure
17603013 Our data suggest that TC1 is a novel heat shock response regulator.
17520678 TC-1 over expression is transforming and may link with the FGFR pathway in a subset of breast cancer.
17178857 Gene induces transformed phenotype when overexpressed in a cancer breast cell line.
16740781 The TC1 coordinates the up-regulation of Wnt/beta-catenin target genes that are implicated in the aggressive biological behavior of cancers.
16424001 data indicate that TC1 is a novel upstream regulator of the Wnt/beta-catenin pathway that enhances aggressive behavior of cancers
15087392 Overexpression of TC-1 may be important in thyroid carcinogenesis.

AA Sequence

MKAKRSHQAVIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAI      1 - 70
DQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH                                       71 - 106
//

Text Mined References (26)

PMID Year Title
26744410 2016 Epigenetic regulation of cyclooxygenase-2 by methylation of c8orf4 in pulmonary fibrosis.
25985737 2015 C8orf4 negatively regulates self-renewal of liver cancer stem cells via suppression of NOTCH2 signalling.
25869879 2015 The high expression of TC1 (C8orf4) was correlated with the expression of ?-catenin and cyclin D1 and the progression of squamous cell carcinomas of the tongue.
24941347 2014 TC-1 overexpression promotes cell proliferation in human non-small cell lung cancer that can be inhibited by PD173074.
24937306 2014 TC1(C8orf4) regulates hematopoietic stem/progenitor cells and hematopoiesis.
23880650 2013 TC-1 (c8orf4) enhances aggressive biologic behavior in lung cancer through the Wnt/?-catenin pathway.
23377761 2013 TC-1 (C8orf4) expression is correlated with differentiation in ovarian carcinomas and might distinguish metastatic ovarian from metastatic colorectal carcinomas.
22658654 2012 Genomic determinants of motor and cognitive outcomes in Parkinson's disease.
20878554 2011 Investigation of copy-number variations of C8orf4 in hematological malignancies.
19684084 2009 TC1(C8orf4) is a novel endothelial inflammatory regulator enhancing NF-kappaB activity.
18959821 2008 TC1 (C8orf4) is involved in ERK1/2 pathway-regulated G(1)- to S-phase transition.
17905836 2007 The intrinsically disordered TC-1 interacts with Chibby via regions with high helical propensity.
17603013 2007 TC1 (C8orf4) is upregulated by cellular stress and mediates heat shock response.
17520678 2007 Transforming properties of TC-1 in human breast cancer: interaction with FGFR2 and beta-catenin signaling pathways.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17178857 2006 Multiple interacting oncogenes on the 8p11-p12 amplicon in human breast cancer.
16740781 2006 TC1(C8orf4) correlates with Wnt/beta-catenin target genes and aggressive biological behavior in gastric cancer.
16730711 2006 TC1(C8orf4) is upregulated by IL-1beta/TNF-alpha and enhances proliferation of human follicular dendritic cells.
16424001 2006 TC1 (C8orf4) enhances the Wnt/beta-catenin pathway by relieving antagonistic activity of Chibby.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15185345 2004 C8orf4 is a transforming growth factor B induced transcript downregulated in metastatic colon cancer.
15087392 2004 TC-1 is a novel tumorigenic and natively disordered protein associated with thyroid cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11056052 2000 Cloning of TC-1 (C8orf4), a novel gene found to be overexpressed in thyroid cancer.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.