Property Summary

NCBI Gene PubMed Count 14
PubMed Score 123.37
PubTator Score 13.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ependymoma 4559 1.2e-14
lung carcinoma 2755 9.6e-11
Disease Target Count Z-score Confidence
Obesity 655 0.0 0.8
Disease Target Count Z-score Confidence
Bardet-Biedl syndrome 51 3.392 1.7
Disease Target Count
cone-rod dystrophy 57

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 2.000 1.2e-14
lung carcinoma 1.300 9.6e-11

Gene RIF (8)

AA Sequence

MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINEI      1 - 70
LEEPNLDKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGTNISWRACDHLRCIACDFLVV     71 - 140
SYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYACQCSWRTIEEVTDLQTDHQLRWVCGKH       141 - 207
//

Text Mined References (13)

PMID Year Title