Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 1.3e-04
colon cancer 1478 2.9e-03
astrocytoma 1146 1.5e-02
ovarian cancer 8520 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.100 1.5e-02
colon cancer 1.400 2.9e-03
nasopharyngeal carcinoma 1.300 1.3e-04
ovarian cancer -1.200 2.2e-02

 Compartment GO Term (1)

AA Sequence

MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKK      1 - 70
QKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIG     71 - 140
AIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSI    141 - 210
WRAKATLDMPDEEFRFNFF                                                       211 - 229
//

Text Mined References (13)

PMID Year Title