Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Duchenne muscular dystrophy 601 6.6e-03
adult high grade glioma 3801 2.2e-02
Disease Target Count Z-score Confidence
Lung squamous cell carcinoma 10 3.616 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma 1.600 2.2e-02
Duchenne muscular dystrophy -1.262 6.6e-03

Synonym

Accession Q8WWR9 G3V137 Q8WVI1
Symbols C8orf22

Gene

  Ortholog (3)

 Compartment GO Term (0)

Protein-protein Interaction (1)

AA Sequence

MASVPSIGCLLARNQYYRKSSVSSVSSLTSSDSVNFIDDDKPQQGLPEVAESTWWFKSFFHSEPVLSNVR      1 - 70
IKDLSATGSLSGRS                                                             71 - 84
//

Text Mined References (5)

PMID Year Title