Property Summary

NCBI Gene PubMed Count 50
PubMed Score 35.44
PubTator Score 129.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.744 1.9e-02
non-small cell lung cancer -2.082 3.4e-19
lung cancer -1.300 5.6e-04
lung adenocarcinoma -1.100 3.1e-13
lung carcinoma -1.400 2.0e-10
ovarian cancer 1.100 5.0e-12

Gene RIF (11)

PMID Text
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19864026 Complement C5b-9 induce a JNK/Bid-dependent and JNK-independent necrotic cell death.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19344414 Observational study of gene-disease association. (HuGE Navigator)
19162005 Cell cycle induction by C5b-9 in aortic endothelial cells is RGC-32 dependent and this is in part through regulation of Akt and growth factor release.
18842294 Observational study of gene-disease association. (HuGE Navigator)
16618117 results indicate that the principal binding site for C9 lies within the MACPF domain of C8alpha; they also suggest this site and the binding sites for C8beta and C8gamma are distinct
12413696 C8 alpha and C8 beta have correspondingly similar roles in MAC-mediated lysis of erythrocytes and bacterial killing. C8 gamma is not required for complement-mediated killing of Gram-negative bacteria.
12220191 The binding specificity between C8 beta and C8 alpha subunits is determined by a cooperative interaction of the N-terminal thrombospondin type 1 module and the membrane attack complex/perforin domain.

AA Sequence

MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTLMPIDCELSSW      1 - 70
SSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLC     71 - 140
NGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRF    141 - 210
RKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIR    211 - 280
RTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVL    281 - 350
GGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV    351 - 420
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMK    421 - 490
QALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGR    491 - 560
RKTRQRQCNNPPPQNGGSPCSGPASETLDCS                                           561 - 591
//

Text Mined References (54)

PMID Year Title
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21454577 2011 Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.
21073882 2011 Structure of human complement C8, a precursor to membrane attack.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19864026 2009 Involvement of the c-jun N-terminal kinases JNK1 and JNK2 in complement-mediated cell death.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19162005 2009 Response gene to complement 32 is required for C5b-9 induced cell cycle activation in endothelial cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16624411 2007 Incorporation of human complement C8 into the membrane attack complex is mediated by a binding site located within the C8beta MACPF domain.
16618117 2006 Functional studies of the MACPF domain of human complement protein C8alpha reveal sites for simultaneous binding of C8beta, C8gamma, and C9.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16199891 2005 Comparative proteomic analysis of intra- and interindividual variation in human cerebrospinal fluid.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12413696 2002 Role of the human C8 subunits in complement-mediated bacterial killing: evidence that C8 gamma is not essential.
12220191 2002 Interaction between the C8 alpha-gamma and C8 beta subunits of human complement C8: role of the C8 beta N-terminal thrombospondin type 1 module and membrane attack complex/perforin domain.
11041874 2000 An indel within the C8 alpha subunit of human complement C8 mediates intracellular binding of C8 gamma and formation of C8 alpha-gamma.
10551839 1999 The four terminal components of the complement system are C-mannosylated on multiple tryptophan residues.
10387094 1999 Chimeric and truncated forms of human complement protein C8 alpha reveal binding sites for C8 beta and C8 gamma within the membrane attack complex/perforin region.
9476133 1997 Molecular, genetic, and functional analysis of homozygous C8 beta-chain deficiency in two siblings.
9476128 1997 Expression of the human complement C8 subunits is independently regulated by interleukin 1 beta, interleukin 6, and interferon gamma.
9165271 1996 Detection of heterozygous C8 beta deficiency by PCR in a healthy Italian population.
8365729 1993 The human complement component C8B gene: structure and phylogenetic relationship.
8345200 1993 Clusterin, the human apolipoprotein and complement inhibitor, binds to complement C7, C8 beta, and the b domain of C9.
8131848 1994 Human complement component C8. Molecular basis of the beta-chain polymorphism.
8098723 1993 Genetic basis of human complement C8 beta deficiency.
8020197 1994 Polymorphism of the complement C8A and -B genes in two families with C8 beta deficiency and neisserial infections.
7710765 1995 Expression of the complement C8 genes during interleukin-6-mediated in vitro induction of the acute-phase response.
7594510 1995 Delineation of additional genetic bases for C8 beta deficiency. Prevalence of null alleles and predominance of C-->T transition in their genesis.
7440581 1980 The eighth component of human complement. Purification and physicochemical characterization of its unusual subunit structure.
6415112 1983 Genetic polymorphism in C8 beta-chains. Evidence for two unlinked genetic loci for the eighth component of human complement (C8).
3879968 1985 Genetic polymorphism of complement component C8.
3676249 1987 The eighth component of human complement: evidence that it is an oligomeric serum protein assembled from products of three different genes.
3651397 1987 Complementary DNA cloning of complement C8 beta and its sequence homology to C9.
3624872 1987 Evidence that C5b recognizes and mediates C8 incorporation into the cytolytic complex of complement.
3435043 1986 The C8A and C8B loci are closely linked on chromosome 1.
3171181 1988 Differential functional expression of the C8 subunits. Primary role of C8 beta in assembly of intact C8.
3052276 1988 Molecular organization and function of the complement system.
2820472 1987 Complementary DNA and derived amino acid sequence of the beta subunit of human complement protein C8: identification of a close structural and ancestral relationship to the alpha subunit and C9.
2759635 1989 C8A and C8B polymorphisms in Norwegians and Norwegian lapps.
2613233 1989 Chromosomal assignment of genes encoding the alpha, beta, and gamma subunits of human complement protein C8: identification of a close physical linkage between the alpha and the beta loci.
2571125 1989 A BamH1 RFLP of the C8B gene.
2284574 1990 Genetic aspects of complement component C8 in Norwegian meningococcal disease patients.
1360193 1992 Linkage and association studies with C8A and C8B RFLPs on chromosome 1.
468996 1979 Genetic control of the eighth component of complement.
451601 1979 Host defense against Neisseria meningitidis requires a complement-dependent bactericidal activity.