Property Summary

NCBI Gene PubMed Count 42
PubMed Score 47.54
PubTator Score 67.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.746 1.7e-02

Gene RIF (17)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19048311 C8gamma binds an indel peptide of C8alpha sequence and forms a non-covalent complex.
18842294 Observational study of gene-disease association. (HuGE Navigator)
18440555 Results describe the crystal structure of the human C8 alpha MACPF domain disulfide-linked to C8 gamma (alphaMACPF-gamma) at 2.15 A resolution.
17872444 crystal structure of the MACPF domain of complement component C8alpha at 2.5 angstrom resolution was determined and it was shown that it is structurally homologous to the bacterial, pore-forming, cholesterol-dependent cytolysins
16935577 One can predict that the indel segment of C8alpha assumes a conformation that allows for multiple points of contact with C8gamma.
16761437 Observational study of genotype prevalence. (HuGE Navigator)
16618117 result suggests that this segment of C8alpha and corresponding segments of the other MAC family members are independently folded domains
12463754 Both N-terminal modules in C8 alpha have a role in forming the principal binding site for C9, and binding may be dependent on a cooperative interaction between these modules and the C8 alpha membrane attack complex/perforin domain.
12413696 C8 alpha and C8 beta have correspondingly similar roles in MAC-mediated lysis of erythrocytes and bacterial killing. C8 gamma is not required for complement-mediated killing of Gram-negative bacteria.
12220191 The binding specificity between C8 alpha and C8 beta subunits is determined by a cooperative interaction of the N-terminal thrombospondin type 1 module and the membrane attack complex/perforin domain.

AA Sequence

MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFG      1 - 70
GTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDC     71 - 140
SQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPY    141 - 210
NFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELN    211 - 280
KYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGI    281 - 350
YEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDII    351 - 420
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQY    421 - 490
LMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRR    491 - 560
ECDNPAPQNGGASCPGRKVQTQAC                                                  561 - 584
//

Text Mined References (46)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239861 2014 Membrane pore formation by human complement: functional importance of the transmembrane ?-hairpin (TMH) segments of C8? and C9.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21507937 2011 Mapping the intermedilysin-human CD59 receptor interface reveals a deep correspondence with the binding site on CD59 for complement binding proteins C8alpha and C9.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19048311 2009 A disulfide linked model of the complement protein C8gamma complexed with C8alpha indel peptide.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18440555 2008 Crystal structure of the MACPF domain of human complement protein C8 alpha in complex with the C8 gamma subunit.
17872444 2007 Structure of C8alpha-MACPF reveals mechanism of membrane attack in complement immune defense.
17692377 2008 Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: implications for C8gamma ligand binding.
16935577 2006 Binding of the lipocalin C8gamma to human complement protein C8alpha is mediated by loops located at the entrance to the C8gamma ligand binding site.
16761437 2006 [Detecting the DNA polymorphism of human complement component C8A by PCR-SSCP analysis].
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16618117 2006 Functional studies of the MACPF domain of human complement protein C8alpha reveal sites for simultaneous binding of C8beta, C8gamma, and C9.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12463754 2002 Binding of human complement C8 to C9: role of the N-terminal modules in the C8 alpha subunit.
12413696 2002 Role of the human C8 subunits in complement-mediated bacterial killing: evidence that C8 gamma is not essential.
12220191 2002 Interaction between the C8 alpha-gamma and C8 beta subunits of human complement C8: role of the C8 beta N-terminal thrombospondin type 1 module and membrane attack complex/perforin domain.
11297196 2001 Detection of mRNA for the terminal complement components C5, C6, C8 and C9 in human umbilical vein endothelial cells in vitro.
11041874 2000 An indel within the C8 alpha subunit of human complement C8 mediates intracellular binding of C8 gamma and formation of C8 alpha-gamma.
10551839 1999 The four terminal components of the complement system are C-mannosylated on multiple tryptophan residues.
10387094 1999 Chimeric and truncated forms of human complement protein C8 alpha reveal binding sites for C8 beta and C8 gamma within the membrane attack complex/perforin region.
9759902 1998 Genetic basis of human complement C8 alpha-gamma deficiency.
9647238 1998 Expression and characterization of recombinant subunits of human complement component C8: further analysis of the function of C8 alpha and C8 gamma.
7759071 1995 Genomic organization of human complement protein C8 alpha and further examination of its linkage to C8 beta.
7649542 1995 The eighth component of human complement: molecular basis of C8A (C81) polymorphism.
7544344 1995 Identity of the segment of human complement C8 recognized by complement regulatory protein CD59.
7440581 1980 The eighth component of human complement. Purification and physicochemical characterization of its unusual subunit structure.
6771072 1980 Recurrent meningococcal infections associated with a functional deficiency of the C8 component of human complement.
4063342 1985 Functional domains of the alpha subunit of the eighth component of human complement: identification and characterization of a distinct binding site for the gamma chain.
4063341 1985 Analysis of the specific association of the eighth and ninth components of human complement: identification of a direct role for the alpha subunit of C8.
3624872 1987 Evidence that C5b recognizes and mediates C8 incorporation into the cytolytic complex of complement.
3171181 1988 Differential functional expression of the C8 subunits. Primary role of C8 beta in assembly of intact C8.
3052276 1988 Molecular organization and function of the complement system.
2820471 1987 Complementary DNA and derived amino acid sequence of the alpha subunit of human complement protein C8: evidence for the existence of a separate alpha subunit messenger RNA.
1551680 1992 Regional chromosomal assignment of genes encoding the alpha and beta subunits of human complement protein C8 to 1p32.