Property Summary

NCBI Gene PubMed Count 46
PubMed Score 0.49
PubTator Score 170.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Osteoporosis 363 3.149 1.6

 Compartment GO Term (0)

Gene RIF (21)

AA Sequence

MYCQDSNICAVFAVQGGKVGRKHGIKRGRRPSIRSPAQRARGPWIHESKHPAFAKQQINLEMPNSRATTE      1 - 70
LAWVCSSTSRKKKWARSLTLSTAPLSPPPSLVHCEDCSCLPGCHSGDLYNLAPAERTC                 71 - 128
//

Text Mined References (46)

PMID Year Title