Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZTY9 A4D2F8
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MRMAPTESTEGRRLWPGPREGGSGKETTSEKLSNLPRPHSYSPKRADAESFRGVPAAFKKCREVFRACWG      1 - 70
SRELLFLFKAISEAGPAQNSCGITLEKAGGLEDTGSHWLSWARCKVLYINGFTDPWKDAQAWILIVSCKK     71 - 140
GKGTPEREGRN                                                               141 - 151
//

Text Mined References (3)

PMID Year Title