Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.27
PubTator Score 0.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.7e-61
nasopharyngeal carcinoma 1058 2.6e-08
atypical teratoid / rhabdoid tumor 5112 2.9e-02
glioblastoma 5792 4.0e-02
ependymoma 4679 5.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 2.9e-02
ependymoma 4.300 5.0e-02
glioblastoma 1.200 4.0e-02
nasopharyngeal carcinoma -3.400 2.6e-08
psoriasis 2.500 8.7e-61

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MRNTSKELQGATHRYAPCDWYYHVPVKRSEKAVDAPPASQIPGLSNLGDSHSENLPGTRRYWIKETDSEY      1 - 70
VKLAKQGGRPDLLKHFAPGTRKGSPVAYSLPDWYIHHSKPPTASQQEVRAVSMPDYMVHEEFNPDQANGS     71 - 140
YASRRGPFDFDMKTVWQREAEELEKEKKKLRLPAIDSKYLSKAGTPLGPKNPAGSRLSFPPVPGQKNSSP    141 - 210
TNFSKLISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPESSQ    211 - 280
SPEESVSASTPAELK                                                           281 - 295
//

Text Mined References (5)

PMID Year Title