Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 2.7e-04
psoriasis 6694 6.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Synonym

Accession Q8WU49
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

AA Sequence

MQVEVQSLSLEECPWRLPGPQCECEALLPSGARRRIDLRLSGRAVAVWVHVRGGPGQFNLSYATGRHKKP      1 - 70
NPHQNMNRGMEFIAPVSAPTKSGAPWHFLSQGPTDAQRAVRIRPGTRMGLSSDPVVGTLSSSYLDLLTLS     71 - 140
YKPGRTVTSSYLNVRGHEVRKLQNSVEATRISRTDSS                                     141 - 177
//

Text Mined References (3)

PMID Year Title