Property Summary

NCBI Gene PubMed Count 7
PubMed Score 56.29
PubTator Score 40.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
chronic rhinosinusitis 512 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Sparganosis 4 4.392 2.2
Diabetic polyneuropathy 3 3.172 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
chronic rhinosinusitis 2.654 1.2e-02

AA Sequence

MAFLPSWVCVLVGSFSASLAGTSNLSETEPPLWKESPGQLSDYRVENSMYIINPWVYLERMGMYKIILNQ      1 - 70
TARYFAKFAPDNEQNILWGLPLQYGWQYRTGRLADPTRRTNCGYESGDHMCISVDSWWADLNYFLSSLPF     71 - 140
LAAVDSGVMGISSDQVRLLPPPKNERKFCYDVSSCRSSFPETMNKWNTFYQYLQSPFSKFDDLLKYLWAA    141 - 210
HTSTLADNIKSFEDRYDYYSKAEAHFERSWVLAVDHLAAVLFPTTLIRSYKFQKGMPPRILLNTDVAPFI    211 - 280
SDFTAFQNVVLVLLNMLDNVDKSIGYLCTEKSNVYRDHSESSSRSYGNNS                        281 - 330
//

Text Mined References (9)

PMID Year Title