Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 7.3e-11
ependymoma 4679 5.4e-05

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.100 5.4e-05
ovarian cancer 1.800 7.3e-11

 Compartment GO Term (1)

AA Sequence

MAQPESSADFGIAQQNNYYCYWQSLPSAIRVKQEFQPSQSYRYGNWYARQHGSYLLSGYSYGCAVDGNGK      1 - 70
DCFSAHETPEHTAGTLVMPKETTPLAENQDEDPLEDPHLHLNIEESNQEFMVKSEELYDSLMNCHWQPLD     71 - 140
TVHSEIPDETPK                                                              141 - 152
//

Text Mined References (3)

PMID Year Title