Property Summary

NCBI Gene PubMed Count 11
PubMed Score 86.02
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.400 4.8e-03
Multiple myeloma 1.702 1.9e-02
ovarian cancer -1.300 7.6e-03

Synonym

Accession Q9UBA6 Q9BW21 Q9UBA7 Q9UBA8
Symbols G8
D6S57

Gene

 Compartment GO Term (2)

Gene RIF (4)

AA Sequence

MERSFVWLSCLDSDSCNLTFRLGEVESHACSPSLLWNLLTQYLPPGAGHILRTYNFPVLSCVSSCHLIGG      1 - 70
KMPEN                                                                      71 - 75
//

Text Mined References (13)

PMID Year Title