Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.37
PubTator Score 32.09

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19143814 Observational study of gene-disease association. (HuGE Navigator)
18955485 G6b-B inhibits constitutive and agonist-induced signaling by glycoprotein VI and CLEC-2.
17678728 G6b-B expression is highly restricted to peripheral CD4+ T cells and up-regulated by the IL-4-induced STAT6 pathway, suggesting that G6b-B is involved in regulation of the immune response by CD4+ T cell-mediated and IL-4 induced regulatory mechanisms.
17311996 G6B represents a novel inhibitory receptor found on the surface of platelets
15848171 Heparin might modulate the interaction of G6b with its as yet unidentified protein ligand

AA Sequence

MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSG      1 - 70
TPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVY     71 - 140
PQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRFAPLVKTEPQRPVKEEEPKIPGDLDQEPSLL    141 - 210
YADLDHLALSRPRRLSTADPADASTIYAVVV                                           211 - 241
//

Text Mined References (20)

PMID Year Title
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19143814 2009 Several loci in the HLA class III region are associated with T1D risk after adjusting for DRB1-DQB1.
18955485 2008 G6b-B inhibits constitutive and agonist-induced signaling by glycoprotein VI and CLEC-2.
18088087 2008 Phosphoproteome of resting human platelets.
17678728 2007 G6b-B cell surface inhibitory receptor expression is highly restricted to CD4+ T-cells and induced by interleukin-4-activated STAT6 pathway.
17311996 2007 The novel inhibitory receptor G6B is expressed on the surface of platelets and attenuates platelet function in vitro.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
15848171 2005 The cell surface receptor G6b, a member of the immunoglobulin superfamily, binds heparin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11544253 2001 G6b, a novel immunoglobulin superfamily member encoded in the human major histocompatibility complex, interacts with SHP-1 and SHP-2.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10384126 1999 Genes encoding three new members of the leukocyte antigen 6 superfamily and a novel member of Ig superfamily, together with genes encoding the regulatory nuclear chloride ion channel protein (hRNCC) and an N omega-N omega-dimethylarginine dimethylaminohydrolase homologue, are found in a 30-kb segment of the MHC class III region.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.