Property Summary

NCBI Gene PubMed Count 15
PubMed Score 624.38
PubTator Score 113.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.300 1.2e-03
osteosarcoma 2.041 1.9e-08

Gene RIF (3)

AA Sequence

MQGRVAGSCAPLGLLLVCLHLPGLFARSIGVVEEKVSQNLGTNLPQLGQPSSTGPSNSEHPQPALDPRSN      1 - 70
DLARVPLKLSVPASDGFPPAGGSAVQRWPPSWGLPAMDSWPPEDPWQMMAAAAEDRLGEALPEELSYLSS     71 - 140
AAALAPGSGPLPGESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWG    141 - 210
TLNPSVSWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWGNINRYPGGSWGNINRYPGGSWGNINRYPG    211 - 280
GSWGNIHLYPGINNPFPPGVLRPPGSSWNIPAGFPNPPSPRLQWG                             281 - 325
//

Text Mined References (16)

PMID Year Title