Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.281 5.5e-04
Atopic dermatitis 1.200 1.0e-03
intraductal papillary-mucinous neoplasm ... 1.800 2.1e-02
nasopharyngeal carcinoma 2.400 1.0e-04
Breast cancer 1.600 2.0e-03
pituitary cancer -1.800 1.0e-04

Synonym

Accession Q5SZD1 A8K1H4 Q8N400 Q96NQ1
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Pathway (1)

AA Sequence

MNDPFARMETRGPQGAANPMDSSRSLGDLGPFPREVGRGAPLAPGARNPATAGASRSQGGGHEDRTADRA      1 - 70
LGPRAGEELDRESWVREKVLFLLHPERWLGTRGDPAREEVAGAEDLPHAGGEDHGEEPNYPSVFQRQKRI     71 - 140
SGRRVAPPRDAADPPKYVLVRVEDYQVTQEVLQTSWAKGRMTTRTEEHFVTALTFRSSREGQPGERWGPA    141 - 210
ESRALQARTGASRVHAAGRRVSPSPGTWLEEIKL                                        211 - 244
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.