Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.11

Knowledge Summary


No data available



  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis 1.200 1.0e-03
Breast cancer 1.600 2.0e-03
intraductal papillary-mucinous neoplasm ... 1.800 2.1e-02
nasopharyngeal carcinoma 1.800 2.2e-04
osteosarcoma -2.281 5.5e-04
pituitary cancer -1.800 1.0e-04

 Compartment GO Term (1)

AA Sequence

ESRALQARTGASRVHAAGRRVSPSPGTWLEEIKL                                        211 - 244

Text Mined References (5)

PMID Year Title