Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.19
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.218 1.1e-04
posterior fossa group B ependymoma -1.400 2.0e-14
glioblastoma -1.300 6.3e-07
sonic hedgehog group medulloblastoma -1.600 1.9e-09
atypical teratoid / rhabdoid tumor -1.400 1.1e-09
medulloblastoma, large-cell -1.600 3.9e-06
pediatric high grade glioma -1.400 9.6e-10
subependymal giant cell astrocytoma -1.720 1.8e-02
Pick disease -1.200 6.2e-04
ulcerative colitis -1.300 3.5e-04
ovarian cancer 1.100 3.1e-06

Gene RIF (1)

PMID Text
22461910 C6orf136 was found to be differentially methylated and differentially expressed in human squamous cell carcinomas

AA Sequence

MYQPSRGAARRLGPCLRAYQARPQDQLYPGTLPFPPLWPHSTTTTSPSSPLFWSPLPPRLPTQRLPQVPP      1 - 70
LPLPQIQALSSAWVVLPPGKGEEGPGPELHSGCLDGLRSLFEGPPCPYPGAWIPFQVPGTAHPSPATPSG     71 - 140
DPSMEEHLSVMYERLRQELPKLFLQSHDYSLYSLDVEFINEILNIRTKGRTWYILSLTLCRFLAWNYFAH    141 - 210
LRLEVLQLTRHPENWTLQARWRLVGLPVHLLFLRFYKRDKDEHYRTYDAYSTFYLNSSGLICRHRLDKLM    211 - 280
PSHSPPTPVKKLLVGALVALGLSEPEPDLNLCSKP                                       281 - 315
//

Text Mined References (9)

PMID Year Title
22461910 2012 FOXM1 induces a global methylation signature that mimics the cancer epigenome in head and neck squamous cell carcinoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.