Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.19
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 3.9e-06
atypical teratoid / rhabdoid tumor -1.400 1.1e-09
ependymoma -1.300 8.2e-19
glioblastoma -1.100 7.5e-06
group 4 medulloblastoma -1.100 3.6e-06
medulloblastoma, large-cell -1.200 1.2e-04
osteosarcoma -1.218 1.1e-04
ovarian cancer 1.100 3.1e-06
Pick disease -1.200 6.2e-04
subependymal giant cell astrocytoma -1.720 1.8e-02
ulcerative colitis -1.300 3.5e-04

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MYQPSRGAARRLGPCLRAYQARPQDQLYPGTLPFPPLWPHSTTTTSPSSPLFWSPLPPRLPTQRLPQVPP      1 - 70
LPLPQIQALSSAWVVLPPGKGEEGPGPELHSGCLDGLRSLFEGPPCPYPGAWIPFQVPGTAHPSPATPSG     71 - 140
DPSMEEHLSVMYERLRQELPKLFLQSHDYSLYSLDVEFINEILNIRTKGRTWYILSLTLCRFLAWNYFAH    141 - 210
LRLEVLQLTRHPENWTLQARWRLVGLPVHLLFLRFYKRDKDEHYRTYDAYSTFYLNSSGLICRHRLDKLM    211 - 280
PSHSPPTPVKKLLVGALVALGLSEPEPDLNLCSKP                                       281 - 315
//

Text Mined References (9)

PMID Year Title