Property Summary

NCBI Gene PubMed Count 25
PubMed Score 2.01
PubTator Score 0.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.500 1.2e-03
Astrocytoma, Pilocytic -1.100 9.9e-04
atypical teratoid / rhabdoid tumor -1.400 4.6e-05
glioblastoma -1.200 9.4e-12
group 3 medulloblastoma -1.100 7.1e-04
intraductal papillary-mucinous carcinoma... 1.100 1.3e-02
medulloblastoma, large-cell -1.600 3.0e-05
osteosarcoma -2.887 1.4e-10
posterior fossa group A ependymoma -1.100 3.1e-10
primitive neuroectodermal tumor -1.200 1.1e-02
psoriasis 1.100 5.9e-07
Rheumatoid arthritis 1.200 2.6e-03
spina bifida -1.297 3.6e-02
subependymal giant cell astrocytoma -1.403 2.8e-02

Gene RIF (8)

AA Sequence

MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNI      1 - 70
SVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIA     71 - 140
DVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNF    141 - 210
NPFASPQKNRQSDENNLKDPGGSEFDSISKNTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNL    211 - 280
SVVTYSKGLHGPYPFGQS                                                        281 - 298
//

Text Mined References (31)

PMID Year Title