Property Summary

NCBI Gene PubMed Count 25
PubMed Score 2.01
PubTator Score 0.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.200 2.6e-03
psoriasis -2.000 3.2e-05
osteosarcoma -2.887 1.4e-10
glioblastoma -1.300 7.1e-04
group 4 medulloblastoma -1.200 8.5e-06
atypical teratoid / rhabdoid tumor -1.400 4.6e-05
medulloblastoma, large-cell -1.600 3.0e-05
primitive neuroectodermal tumor -1.400 9.9e-06
intraductal papillary-mucinous carcinoma... 1.100 1.3e-02
adult high grade glioma -1.500 1.2e-03
pilocytic astrocytoma -1.200 1.6e-09
posterior fossa group A ependymoma -1.100 3.1e-10
subependymal giant cell astrocytoma -1.403 2.8e-02
spina bifida -1.297 3.6e-02

Synonym

Accession Q9H6K1 B2R8K7 Q5VV77 Q96MG5 Q9BUR9
Symbols FP852
dJ391O22.4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
25953261 High C6orf106 expression was significantly correlated with lymph node metastasis in triple-negative breast cancer.
25736925 C6orf106 promotes invasion in NSCLC cells. Finally, C6orf106 upregulates vimentin, and downregulates E-cadherin and P120ctn.
20846217 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
19059477 up-regulated expression by repetitive low-grade oxidative stress through p38MAPK or NF-kappaB pathways
18793612 DSCR2 was found to interact with PPARbeta and to inhibit it.
18003597 Ethanol, but not acetaldehyde, inhibited PPAR-beta transactivation.

AA Sequence

MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNI      1 - 70
SVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIA     71 - 140
DVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNF    141 - 210
NPFASPQKNRQSDENNLKDPGGSEFDSISKNTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNL    211 - 280
SVVTYSKGLHGPYPFGQS                                                        281 - 298
//

Text Mined References (31)

PMID Year Title
25953261 2015 A novel biomarker C6orf106 promotes the malignant progression of breast cancer.
25736925 2015 C6orf106 enhances NSCLC cell invasion by upregulating vimentin, and downregulating E-cadherin and P120ctn.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23940030 2013 The F-box protein FBXO25 promotes the proteasome-dependent degradation of ELK-1 protein.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21832049 2011 Interactions of pathological hallmark proteins: tubulin polymerization promoting protein/p25, beta-amyloid, and alpha-synuclein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20846217 2010 Association of linear growth impairment in pediatric Crohn's disease and a known height locus: a pilot study.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
19322201 2009 Ubiquitin-mediated proteolysis of HuR by heat shock.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
19059477 2009 Enhancement of PPAR-beta activity by repetitive low-grade H(2)O(2) stress protects human umbilical vein endothelial cells from subsequent oxidative stress-induced apoptosis.
18793612 2008 Down syndrome critical region 2 protein inhibits the transcriptional activity of peroxisome proliferator-activated receptor beta in HEK293 cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18391952 2008 Genome-wide association analysis identifies 20 loci that influence adult height.
18003597 2008 PPARalpha and PPARbeta are differentially affected by ethanol and the ethanol metabolite acetaldehyde in the MCF-7 breast cancer cell line.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.