Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.08
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

 Compartment GO Term (1)

AA Sequence

MLWFQGNSMQLARSSFGLFLRNCSASKTTLPVLTLFTKDPCPLCDEAKEVLKPYENRQPYKDQKLPGTRR      1 - 70
RRSPSSPSHPHMASQSGKRYNLTLNQVLSFDYDMGLDAPKTISSDCGAFYCLRMFKSPDMTCCFYPKQ       71 - 138
//

Text Mined References (2)

PMID Year Title