Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -3.514 1.3e-11
medulloblastoma, large-cell -1.200 2.3e-03
non-small cell lung cancer -1.436 7.8e-19
intraductal papillary-mucinous adenoma (... 1.200 5.8e-03
active Crohn's disease 1.084 4.4e-03

Synonym

Accession Q8N8D9 A1L3V9 A6NKA0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19760754 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDSLAAGELNASHQPWVPEFVAYWRKTHQGNLQTLLLHWLLLCSCLHHLYNASCHPAFPVEYSHAVCCLQ      1 - 70
PRFWKEMSPFSSSSTTHLFSKCFFYTCLCWAWQQCSSEQNHQPCSHAAYNQVERQT                   71 - 126
//

Text Mined References (13)

PMID Year Title
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22561531 2012 Genome-wide association study to identify genetic determinants of severe asthma.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20570966 2010 Fucosyltransferase 2 (FUT2) non-secretor status is associated with Crohn's disease.
20031577 2009 Novel loci, including those related to Crohn disease, psoriasis, and inflammation, identified in a genome-wide association study of fibrinogen in 17 686 women: the Women's Genome Health Study.
20031576 2009 Association of novel genetic Loci with circulating fibrinogen levels: a genome-wide association study in 6 population-based cohorts.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
18587394 2008 Genome-wide association defines more than 30 distinct susceptibility loci for Crohn's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.