Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Joubert syndrome 66 3.772 1.9
Coloboma 51 3.657 1.8

Synonym

Accession A6NGY3
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MTQPTRPSVTCDQGSSTIGGTAAQATTSSSATSGSNYQRDRLGRRPEIGVGGQPQICFPRPRSAQQPVLF      1 - 70
SLMNSSEAAMKKTLPKSHLSRVIIHDNRITQRIYEMEVSALEKTKKKISHYYEHLKKKFMTEQLRKLGRW     71 - 140
REESVNSNRYLTFGIPPPV                                                       141 - 159
//

Text Mined References (2)

PMID Year Title