Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.400 7.6e-03
posterior fossa group B ependymoma 3.700 1.0e-14
medulloblastoma -1.100 1.5e-06
medulloblastoma, large-cell -1.100 8.7e-04
nasopharyngeal carcinoma -2.100 8.0e-08
chronic rhinosinusitis -1.606 3.2e-02
psoriasis -2.600 9.1e-70

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEDDEEETTASTLRGKPRPPPVSAQSAFSYIPPRRLDPKEHSYYYRPARTGIISLYDCIFKRRLDYDQKL      1 - 70
HRDDREHAKSLGLHVNEEEQERPVGVLTSSVYGKRINQPIEPLNRDFGRANHVQADFYRKNDIPSLKEPG     71 - 140
FGHIAPS                                                                   141 - 147
//

Text Mined References (3)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.