Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
oligodendroglioma 1.100 5.1e-03
osteosarcoma 2.845 6.3e-06
atypical teratoid / rhabdoid tumor 1.300 2.6e-02
glioblastoma 1.200 2.4e-02
group 4 medulloblastoma 1.800 2.2e-03
medulloblastoma, large-cell 1.900 2.2e-05
juvenile dermatomyositis 1.013 1.2e-10
acute quadriplegic myopathy 1.210 1.9e-06
primary pancreatic ductal adenocarcinoma 1.081 8.2e-03
tuberculosis and treatment for 6 months 1.300 4.4e-04
Breast cancer 2.400 2.7e-02
pediatric high grade glioma 1.400 9.4e-03
pilocytic astrocytoma 1.100 3.1e-02
aldosterone-producing adenoma -1.319 1.1e-02

 Compartment GO Term (1)

AA Sequence

MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGR      1 - 70
SIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGR     71 - 140
PPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE                          141 - 188
//

Text Mined References (10)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.