Property Summary

NCBI Gene PubMed Count 40
PubMed Score 63.30
PubTator Score 51.22

Knowledge Summary

Patent (4,003)

TINX Plot

  Disease (2)

Disease Target Count P-value
mucosa-associated lymphoid tissue lymphoma 480 1.7e-02
Disease Target Count Z-score Confidence
Complement component 3 deficiency 8 3.866 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 2.010 1.7e-02

Gene RIF (31)

PMID Text
26283482 this study reveals a novel role for C5aR2 in C5a-mediated activation of mast cells and demonstrates that C5aR2 ligation initiates a beta-arrestin-2-, PI3K-, and ERK-dependent signaling pathway in these cells.
25935173 All the C698T genotypes and allele frequencies in C5L2 were almost similar in both the cases and controls.
25726869 C5AR and C5L2-mediated neutrophil dysfunction is associated with a poor outcome in sepsis.
24885523 The present study has extended the mutation spectrum of C5L2, and Thr196Asn mutations in C5L2 were associated with retinitis pigmentosa and serum lipid levels.
24819959 prominent C5L2 expression in advanced atherosclerotic stages directly correlates with high levels of proinflammatory cytokines
24777312 C5a2 can modulate ERK1/2 signaling in macrophages via heteromer formation with C5a1 and beta-arrestin recruitment.
24523571 C5aR and C5L2 may have roles in adiposity in women
24078164 our study indicates that 698C>T polymorphism of C5L2 gene is associated with the T2DM in individuals of Saudi population which was found to be similar with other studies.
24073849 A novel polymorphism (901G > a) of C5L2 gene is associated with coronary artery disease in Chinese Han and Uyghur population.
23785491 C5L2 may be implicated in the pro-inflammatory role in C5a-primed neutrophils for ANCA-induced activation.
23460866 The results suggest that insulin sensitivity may be permissive for coupling of C5L2 levels to lipid storage and utilization.
23394121 C5L2 receptors are abundant in neurofibrillary tangles in Alzheimer's disease brain compared to controls.
23239822 C5L2 has been recently demonstrated to physically interact with both C5aR and beta-arrestin to negatively regulate C5aR signaling toward an anti-inflammatory manner
22960554 C5L2 was expressed in the kidney and localized to the distal convoluted tubule and connecting tubule.
22194190 Neither the familial combined hyperlipidemia subjects nor the type 2 diabetes patients were found to have the S323I variant of the C5L2 gene.
22187344 The aim of this study was to investigate the genetic alterations and mRNA expression pattern of C5aR and C5L2 genes in neutrophils from attack-free familial Mediterranean fever patients.
22180093 genetic association studies in the Chinese Han population: Data suggest that an SNP in C5L2 (C698T) is associated with type 2 diabetes mellitus; 698CT heterozygotes exhibited increased serum triglyceride levels.
21698200 698CT genotype of C5L2 may be a genetic maker of CAD in the Han and Uygur population in western China
21630250 negatively modulated during TLR-mediated enhancement of C5a-induced proinflammatory responses
20044484 Data show that C5L2 is predominantly intracellular, while C5aR is expressed on the plasma membrane, and that internalized C5aR following ligand binding is co-localized with both C5L2 and beta-arrestin.
19767107 Recombinant C3adesArg/acylation stimulating protein (ASP) is highly bioactive: a critical evaluation of C5L2 binding and 3T3-L1 adipocyte activation.
19615750 C5L2 is a functional metabolic receptor, and serine 323 is important for ASP induced functionality.
19100624 a major function of human C5L2 is to remove active complement fragments from the extracellular environment.
17158873 C5L2 appears to bind complement factor C5a and C5a des Arg by different mechanisms, and, unlike C5a receptor (C5aR), C5L2 uses critical residues in its N-terminal domain for binding only to C5a des Arg.
17068344 C5L2 is a highly regulated scavenger receptor for C5a and C5a-des-Arg(74)
15833747 first demonstration that C5L2 is a functional receptor, mediating acylation-stimulating protein triglyceride stimulation
15634936 C5L2 on neutrophils diminishes during sepsis due to systemic generation of complement 5a (C5a), which is associated with a poor prognosis.
14570896 A8Delta71-73 is the first antagonist of c5a that blocks C5a and C5adesArg74 binding to C5L2 making it a valuable tool for studying C5L2 functions.
12540846 C3a des Arg77 binds to C5L2 but not to the C3a receptor (LocusID: 719). C3a and C3a des Arg77 both stimulate triglyceride synthesis (acylation stimulating protein, ASP) in adipocytes and fibroblasts and so C5L2 could be the receptor for ASP.
11773063 These results suggest that C5L2 is an anaphylatoxin-binding protein with unique ligand binding and signaling properties.
11773063 C5L2 is a high affinity binding protein for C5a and C5a des Arg74, and has a moderate affinity for C3a. Unlike the original receptors for C5a (CD88) and C3a (C3aR), C5L2 couples weakly to Gi-mediated signalling pathways.

AA Sequence

MGNDSVSYEYGDYSDLSDRPVDCLDGACLAIDPLRVAPLPLYAAIFLVGVPGNAMVAWVAGKVARRRVGA      1 - 70
TWLLHLAVADLLCCLSLPILAVPIARGGHWPYGAVGCRALPSIILLTMYASVLLLAALSADLCFLALGPA     71 - 140
WWSTVQRACGVQVACGAAWTLALLLTVPSAIYRRLHQEHFPARLQCVVDYGGSSSTENAVTAIRFLFGFL    141 - 210
GPLVAVASCHSALLCWAARRCRPLGTAIVVGFFVCWAPYHLLGLVLTVAAPNSALLARALRAEPLIVGLA    211 - 280
LAHSCLNPMLFLYFGRAQLRRSLPAACHWALRESQGQDESVDSKKSTSHDLVSEMEV                 281 - 337
//

Text Mined References (43)

PMID Year Title
26283482 2015 The Novel Receptor C5aR2 Is Required for C5a-Mediated Human Mast Cell Adhesion, Migration, and Proinflammatory Mediator Production.
25935173 2015 Genetic polymorphisms in paraoxonase 1 and G protein-coupled receptor 77, and the risk of glucose-6-phosphate dehydrogenase deficiency in a Saudi population.
25726869 2016 Complement 5a receptor-mediated neutrophil dysfunction is associated with a poor outcome in sepsis.
24885523 2014 A novel mutation in C5L2 gene was associated with hyperlipidemia and retinitis pigmentosa in a Chinese family.
24819959 2014 High expression of C5L2 correlates with high proinflammatory cytokine expression in advanced human atherosclerotic plaques.
24777312 2014 C5a2 can modulate ERK1/2 signaling in macrophages via heteromer formation with C5a1 and ?-arrestin recruitment.
24523571 2014 Association of immune and metabolic receptors C5aR and C5L2 with adiposity in women.
24078164 2013 Circulating C5L2 gene polymorphism is associated with type 2 diabetes mellitus in Saudi population.
24073849 2013 A novel polymorphism (901G > a) of C5L2 gene is associated with coronary artery disease in Chinese Han and Uyghur population.
23785491 2013 A pro-inflammatory role of C5L2 in C5a-primed neutrophils for ANCA-induced activation.
23460866 2013 Relationship of C5L2 receptor to skeletal muscle substrate utilization.
23394121 2013 Complement activation fragment C5a receptors, CD88 and C5L2, are associated with neurofibrillary pathology.
23239822 2013 C5L2: a controversial receptor of complement anaphylatoxin, C5a.
22960554 2013 Novel insights in localization and expression levels of C5aR and C5L2 under native and post-transplant conditions in the kidney.
22812419 2012 Structure, function and control of complement C5 and its proteolytic fragments.
22496247 2012 Human colonic epithelial cells detect and respond to C5a via apically expressed C5aR through the ERK pathway.
22441801 2012 Complement C5A regulates prolabor mediators in human placenta.
22194190 2011 S323I polymorphism of the C5L2 gene was not identified in a Chinese population with familial combined hyperlipidemia or with type 2 diabetes.
22187344 2012 Genetic analysis of C5a receptors in neutrophils from patients with familial Mediterranean fever.
22180093 2012 Relationship between type 2 diabetes mellitus and a novel polymorphism C698T in C5L2 in the Chinese Han population.
21698200 2011 Relationship between a novel polymorphism of the C5L2 gene and coronary artery disease.
21630250 2011 TLR activation enhances C5a-induced pro-inflammatory responses by negatively modulating the second C5a receptor, C5L2.
20044484 2010 The C5a receptor (C5aR) C5L2 is a modulator of C5aR-mediated signal transduction.
19767107 2009 Recombinant C3adesArg/acylation stimulating protein (ASP) is highly bioactive: a critical evaluation of C5L2 binding and 3T3-L1 adipocyte activation.
19615750 2009 C5a- and ASP-mediated C5L2 activation, endocytosis and recycling are lost in S323I-C5L2 mutation.
19100624 2009 The human complement fragment receptor, C5L2, is a recycling decoy receptor.
17158873 2007 The role of the N-terminal domain of the complement fragment receptor C5L2 in ligand binding.
17068344 2006 Ligand specificity of the anaphylatoxin C5L2 receptor and its regulation on myeloid and epithelial cell lines.
16627811 2006 Identification of a novel C5L2 variant (S323I) in a French Canadian family with familial combined hyperlipemia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16204243 2005 An anti-inflammatory function for the complement anaphylatoxin C5a-binding protein, C5L2.
15833747 2005 C5L2 is a functional receptor for acylation-stimulating protein.
15634936 2005 Changes in the novel orphan, C5a receptor (C5L2), during experimental sepsis and sepsis in humans.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14570896 2004 C5a mutants are potent antagonists of the C5a receptor (CD88) and of C5L2: position 69 is the locus that determines agonism or antagonism.
12540846 2003 The chemoattractant receptor-like protein C5L2 binds the C3a des-Arg77/acylation-stimulating protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11773063 2002 The orphan receptor C5L2 has high affinity binding sites for complement fragments C5a and C5a des-Arg(74).
11165367 2001 Identification of four novel human G protein-coupled receptors expressed in the brain.
11090875 2000 A putative chemoattractant receptor, C5L2, is expressed in granulocyte and immature dendritic cells, but not in mature dendritic cells.