Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 437 0.0 1.7

Expression

Gene RIF (1)

AA Sequence

MAYGVPRKNTVKTILRGSCYNVQEPWDIALLAKTWSTNLANIKLPFLEEISFGGSVQLTKCTTIKDGLLP      1 - 70
SAESIKLEREYEVKRLCKLKCQENTSKEIQLLLRERPAGLRRPLPSK                            71 - 117
//

Text Mined References (7)

PMID Year Title