Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.800 2.7e-06
colon cancer -2.000 2.1e-02
ductal carcinoma in situ -2.400 2.7e-05
esophageal adenocarcinoma 1.100 2.0e-02
glioblastoma -1.400 2.8e-04
group 3 medulloblastoma -2.100 1.4e-05
interstitial cystitis -1.500 3.8e-02
lung adenocarcinoma -1.200 1.5e-08
lung cancer -2.500 1.5e-04
lung carcinoma -1.400 3.3e-13
medulloblastoma, large-cell -2.100 5.1e-06
nasopharyngeal carcinoma -1.200 3.0e-07
primitive neuroectodermal tumor -1.400 2.1e-02
spina bifida -2.663 4.1e-02

Gene RIF (1)

AA Sequence

MGCRCCKIIQSYLFDPVQVPSPGYVNEVNSCKLDEDDTDKLKGKWSSEVLVQKNDPQRQGSKKTESSSRT      1 - 70
ADPWEPCWPHQGPLPQGDAGGEHHACGVNGIGPAATPQPTGNSSPTQDDRGSWASTANTVPPTQPFLEGG     71 - 140
GTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKN    141 - 210
HTEDESLEGIQPPVGEHGLNTPFSVRRSWDSLNEDVETEVLSICFNEKGPVHAMPVVDSGNRQEDTHGSD    211 - 280
GDGDGEIVDEDAAVAEALAALEAATAGEDLDETD                                        281 - 314
//

Text Mined References (10)

PMID Year Title