Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma 1.100 2.0e-02
medulloblastoma -2.200 1.1e-10
atypical teratoid / rhabdoid tumor -1.800 2.7e-06
glioblastoma -1.400 2.8e-04
medulloblastoma, large-cell -2.100 5.1e-06
primitive neuroectodermal tumor -1.400 2.1e-02
lung cancer -2.500 1.5e-04
colon cancer -2.000 2.1e-02
interstitial cystitis -2.100 9.9e-05
lung adenocarcinoma -1.200 1.5e-08
nasopharyngeal carcinoma -1.200 3.0e-07
lung carcinoma -1.400 3.3e-13
spina bifida -2.663 4.1e-02
ductal carcinoma in situ -2.400 2.7e-05

Synonym

Accession Q8IY42 Q9NV03
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGCRCCKIIQSYLFDPVQVPSPGYVNEVNSCKLDEDDTDKLKGKWSSEVLVQKNDPQRQGSKKTESSSRT      1 - 70
ADPWEPCWPHQGPLPQGDAGGEHHACGVNGIGPAATPQPTGNSSPTQDDRGSWASTANTVPPTQPFLEGG     71 - 140
GTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKN    141 - 210
HTEDESLEGIQPPVGEHGLNTPFSVRRSWDSLNEDVETEVLSICFNEKGPVHAMPVVDSGNRQEDTHGSD    211 - 280
GDGDGEIVDEDAAVAEALAALEAATAGEDLDETD                                        281 - 314
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20802204 2010 Genetic variation influences glutamate concentrations in brains of patients with multiple sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.