Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.15
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 3 medulloblastoma 2254 1.6e-02

Synonym

Accession Q53FE4 Q6FI84 Q6IS77 Q8NA78 Q9H0D9
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

 GWAS Trait (1)

 HCA RNA Cell Line (2)

Pathway (1)

AA Sequence

MNLNPPTSALQIEGKGSHIMARNVSCFLVRHTPHPRRVCHIKGLNNIPICTVNDDENAFGTLWGVGQSNY      1 - 70
LEKNRIPFANCSYPSSTAVQESPVRGMSPAPNGAKVPPRPHSEPSRKIKECFKTSSENPLVIKKEEIKAK     71 - 140
RPPSPPKACSTPGSCSSGMTSTKNDVKANTICIPNYLDQEIKILAKLCSILHTDSLAEVLQWLLHATSKE    141 - 210
KEWVSALIHSELAEINLLTHHRRNTSMEPAAETGKPPTVKSPPTVKLPPNFTAKSKVLTRDTEGDQPTRV    211 - 280
SSQGSEENKEVPKEAEHKPPLLIRRNNMKIPVAEYFSKPNSPPRPNTQESGSAKPVSARSIQEYNLCPQR    281 - 350
ACYPSTHRR                                                                 351 - 359
//

Text Mined References (10)

PMID Year Title
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23568457 2013 Genetic variants associated with disordered eating.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.