Property Summary

NCBI Gene PubMed Count 71
PubMed Score 244.70
PubTator Score 463.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 3.395 9.6e-04
active ulcerative colitis 2.862 6.7e-03
Breast cancer -3.100 3.9e-48
intraductal papillary-mucinous neoplasm ... 3.700 2.8e-03
lung adenocarcinoma -1.900 1.3e-05
lung cancer -3.800 1.4e-06
lung carcinoma -5.400 4.8e-32
non-small cell lung cancer -3.437 4.5e-13
ovarian cancer -3.600 6.4e-09
pancreatic ductal adenocarcinoma liver m... -2.607 4.3e-02

Gene RIF (46)

AA Sequence

MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETR      1 - 70
FKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSC     71 - 140
SEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLL    141 - 210
GHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIH    211 - 280
CDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQK    281 - 350
NLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTP    351 - 420
SCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELV    421 - 490
NGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLP    491 - 560
NPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL                                     561 - 597
//

Text Mined References (75)

PMID Year Title