Property Summary

NCBI Gene PubMed Count 68
PubMed Score 274.09
PubTator Score 463.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.607 4.3e-02
non-small cell lung cancer -3.437 4.5e-13
intraductal papillary-mucinous neoplasm ... 3.700 2.8e-03
lung cancer -6.300 1.4e-07
active Crohn's disease 3.395 9.6e-04
ulcerative colitis 3.100 7.8e-05
lung adenocarcinoma -2.100 3.1e-03
lung carcinoma -5.400 4.8e-32
Breast cancer -3.100 3.9e-48
ovarian cancer -3.600 6.4e-09

Gene RIF (43)

PMID Text
26897815 C4BP is deposited in the diseased aortic valve, coincident with C3d expression.
26658464 genetic polymorphism is associated with spontaneous abortion; review
26067271 whereas the presence of plasminogen did not affect the factor I cofactor activity of C4BP, the activation of plasminogen by urokinase-type plasminogen activator to active plasmin was significantly augmented in the presence of C4BP.
25660618 C4BPB/C4BPA may not confer susceptibility to schizophrenia among Han Chinese
24779215 In patients treated with tacrolimus and mycophenolate mophetil as a maintenance immunosuppression, the lower C4d urinary excretion in early post-transplant period seems to be a low significance prognostic marker of a better long-term kidney outcome.
24760758 these data suggest that when C4BP is bound to Ail, fI can cleave and inactivate C4b that has bound covalently to bacterial surface structures as well as C4b bound noncovalently to Ail.
23508668 mutations in women experiencing recurrent miscarriages
23390292 C4BP alpha7beta0 isoform complement control protein-6 domain of C4BP alpha-chain is necessary for tolerogenic activity of the acute-phase C4BPbeta chain.
23274142 The heptameric core structure is stabilized by intermolecular disulfide bonds.
22925928 Human pneumococcal glycolytic enzyme enolase, a nonclassical cell surface and plasminogen-binding protein, is a pneumococcal C4BP-binding protein.
22732096 The Lsa30 (LIC110870) is a novel adhesin that binds plasminogen and the complement regulator C4bp.
22333221 C4BP is recruited to the S. aureus surface where it functions to inhibit C4 complement effectors, suggesting a previously undescribed immune evasion strategy for this pathogen.
21915248 Human pentraxin 3 binds to the complement regulator c4b-binding protein.
21659506 NC4 Domain of cartilage-specific collagen IX inhibits complement directly due to attenuation of membrane attack formation and indirectly through binding and enhancing activity of complement inhibitors C4B-binding protein and factor H.
21262398 Serum C4BP level in 89 patients showed a strong association with the clinical staging of non small cell lung carcinoma.
20532227 Show that B. recurrentis spirochetes express another potential outer membrane lipoprotein, termed CihC, and acquire C4b-binding protein (C4bp) and human C1 esterase inhibitor (C1-Inh).
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20212171 C4BPB/C4BPA is a new susceptibility locus for venous thrombosis with unknown protein S-independent mechanism: results from genome-wide association and gene expression analyses followed by case-control studies.
20212171 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20059470 Observational study of gene-disease association. (HuGE Navigator)
20022381 Binding of the classical pathway inhibitor, C4b-binding protein (C4bp), to three genospecies of B. burgdorferi sensu lato, is demonstrated.
19494311 C4BP binding varies between strains but is dependent on the expression of pneumococcal surface protein C, PspC of group 4
19423540 Observational study of gene-disease association. (HuGE Navigator)
19417080 isoforms of a group B streptococcus-secreted component named Fib displayed differential binding capacities for fibronectin, fibrinogen, and C4BP
19344414 Observational study of gene-disease association. (HuGE Navigator)
19155499 Mainly the central core of C4BP mediates binding to small leucine-rich repeat proteins (SLRPs). Binding of SLRPs to C4BP does not not affect its ability to inhibit complement.
19076829 Observational study of gene-disease association. (HuGE Navigator)
18842294 Observational study of gene-disease association. (HuGE Navigator)
18715646 These results reinforce the case for the occupation of some of the seven arms of C4BP in a multivalent interaction with DNA or surface bound glycosaminoglycans while other arms engage C4b or C3b.
18556068 C4BP binds to dead brain cells and Abeta peptide in vitro, is present in CSF and possibly protects against excessive complement activation in AD brains.
18424762 A novel non-synonymous polymorphism (p.Arg240His) in C4b-binding protein is associated with atypical hemolytic uremic syndrome and leads to impaired alternative pathway cofactor activity.
18424762 Observational study of gene-disease association. (HuGE Navigator)
18406463 various conformational isoforms (native, amyloid fibrils, and beta-oligomers) of recombinant human PrP (90-231 and 121-231) bind C1q and activate complement.
17579075 The binding sites to Neisseria gonorrhoeae Por1A protein have been mapped within complement control protein domain 1 of C4BP.
17548110 Non-small cell lung cancer (NSCLC) cells produce soluble complement inhibitors factor I (FI) and C4b-binding protein (C4BP).
17225862 Data show that C4BP does not bind CD40, but it forms stable high molecular weight complexes with soluble CD40 ligand (sCD154).
16819837 To determine the regions of C4b contributing to C4BP binding, the binding of the C4c and C4dg subfragments of C4b to C4BP was examined.
15179322 Localization of binding sites for a number of C4BP ligands in relation to well-established and novel functions of C4BP. Review
12893820 C4b and C3b do not undergo the same conformational changes upon binding to the C4BP mutants as during the interaction with the wild type C4BP, which then results in an observed loss of the cofactor activity
12135356 structural requirements for the intracellular subunit polymerization
11441101 The primary binding site on C4bp is located on the alpha-chain complement control protein 4 (CCP4) domain which, unlike C4bp alpha-chain amino-terminal CCP1 and CCP2, is not involved in complement regulatory activity.

AA Sequence

MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETR      1 - 70
FKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSC     71 - 140
SEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLL    141 - 210
GHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIH    211 - 280
CDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQK    281 - 350
NLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTP    351 - 420
SCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELV    421 - 490
NGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLP    491 - 560
NPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL                                     561 - 597
//

Text Mined References (72)

PMID Year Title
26897815 2015 C4b-Binding Protein Deposition is Induced in Diseased Aortic Heart Valves, Coinciding with C3d.
26658464 2016 C4b-binding protein: The good, the bad and the deadly. Novel functions of an old friend.
26067271 2015 A Novel Interaction between Complement Inhibitor C4b-binding Protein and Plasminogen That Enhances Plasminogen Activation.
25660618 2015 An evaluation of association between common variants in C4BPB/C4BPA genes and schizophrenia.
24779215 2014 [The early C4d urinary excretion and long-term kidney graft survival in patients treated with tacrolimus and mycophenolate mophetil].
24760758 2014 Yersinia pestis Ail recruitment of C4b-binding protein leads to factor I-mediated inactivation of covalently and noncovalently bound C4b.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23508668 2013 Analysis of genes coding for CD46, CD55, and C4b-binding protein in patients with idiopathic, recurrent, spontaneous pregnancy loss.
23390292 2013 The ?7?0 isoform of the complement regulator C4b-binding protein induces a semimature, anti-inflammatory state in dendritic cells.
23274142 2013 Arranged sevenfold: structural insights into the C-terminal oligomerization domain of human C4b-binding protein.
22925928 2012 Enolase of Streptococcus pneumoniae binds human complement inhibitor C4b-binding protein and contributes to complement evasion.
22732096 2012 Lsa30, a novel adhesin of Leptospira interrogans binds human plasminogen and the complement regulator C4bp.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22333221 2012 Complement regulator C4BP binds to Staphylococcus aureus and decreases opsonization.
21915248 2011 Human pentraxin 3 binds to the complement regulator c4b-binding protein.
21659506 2011 NC4 Domain of cartilage-specific collagen IX inhibits complement directly due to attenuation of membrane attack formation and indirectly through binding and enhancing activity of complement inhibitors C4B-binding protein and factor H.
21262398 2011 A high-quality secretome of A549 cells aided the discovery of C4b-binding protein as a novel serum biomarker for non-small cell lung cancer.
20532227 2010 Human complement regulators C4b-binding protein and C1 esterase inhibitor interact with a novel outer surface protein of Borrelia recurrentis.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20212171 2010 C4BPB/C4BPA is a new susceptibility locus for venous thrombosis with unknown protein S-independent mechanism: results from genome-wide association and gene expression analyses followed by case-control studies.
20059470 2010 Epidemiological approach to identifying genetic predispositions for atypical hemolytic uremic syndrome.
20022381 2010 Binding of the complement inhibitor C4b-binding protein to Lyme disease Borreliae.
19494311 2009 Clinical isolates of Streptococcus pneumoniae bind the complement inhibitor C4b-binding protein in a PspC allele-dependent fashion.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19417080 2009 Capturing host-pathogen interactions by protein microarrays: identification of novel streptococcal proteins binding to human fibronectin, fibrinogen, and C4BP.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19155499 2009 Complement inhibitor C4b-binding protein interacts directly with small glycoproteins of the extracellular matrix.
19076829 2009 Lack of association between polymorphisms in C4b-binding protein and atypical haemolytic uraemic syndrome in the Spanish population.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18715646 2008 Structural basis and functional effects of the interaction between complement inhibitor C4b-binding protein and DNA.
18556068 2008 C4b-binding protein in Alzheimer's disease: binding to Abeta1-42 and to dead cells.
18424762 2008 A novel non-synonymous polymorphism (p.Arg240His) in C4b-binding protein is associated with atypical hemolytic uremic syndrome and leads to impaired alternative pathway cofactor activity.
18406463 2008 Native, amyloid fibrils and beta-oligomers of the C-terminal domain of human prion protein display differential activation of complement and bind C1q, factor H and C4b-binding protein directly.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17579075 2007 Molecular characterization of the interaction between porins of Neisseria gonorrhoeae and C4b-binding protein.
17548110 2008 Non-small cell lung cancer cells produce a functional set of complement factor I and its soluble cofactors.
17225862 2007 C4b binding protein binds to CD154 preventing CD40 mediated cholangiocyte apoptosis: a novel link between complement and epithelial cell survival.
16819837 2006 The complement regulator C4b-binding protein (C4BP) interacts with both the C4c and C4dg subfragments of the parent C4b ligand: evidence for synergy in C4BP subsite binding.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16330538 2006 Human C4b-binding protein, structural basis for interaction with streptococcal M protein, a major bacterial virulence factor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15188402 2004 Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
15179322 Functions of human complement inhibitor C4b-binding protein in relation to its structure.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14607961 2003 Inhibition of fibrocyte differentiation by serum amyloid P.
12893820 2003 Mutations in alpha-chain of C4BP that selectively affect its factor I cofactor function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11705989 2002 The alpha -chains of C4b-binding protein mediate complex formation with low density lipoprotein receptor-related protein.
11441101 2001 Regulation of complement classical pathway by association of C4b-binding protein to the surfaces of SK-OV-3 and Caov-3 ovarian adenocarcinoma cells.
10383431 1999 A cluster of positively charged amino acids in the C4BP alpha-chain is crucial for C4b binding and factor I cofactor function.
9089100 1997 A high-resolution map of the regulator of the complement activation gene cluster on 1q32 that integrates new genes and markers.
8406448 1993 C4BPAL1, a member of the human regulator of complement activation (RCA) gene cluster that resulted from the duplication of the gene coding for the alpha-chain of C4b-binding protein.
7806286 1995 C4BPAL2: a second duplication of the C4BPA gene in the human RCA gene cluster.
7772049 1995 Expression of the human gene coding for the alpha-chain of C4b-binding protein, C4BPA, is controlled by an HNF1-dependent hepatic-specific promoter.
7592941 1995 Serum amyloid P component binding to C4b-binding protein.
6222381 1983 Visualization of human C4b-binding protein and its complexes with vitamin K-dependent protein S and complement protein C4b.
4033666 1985 Amino acid sequence studies of human C4b-binding protein: N-terminal sequence analysis and alignment of the fragments produced by limited proteolysis with chymotrypsin and the peptides produced by cyanogen bromide treatment.
3840370 1985 Molecular cloning and characterization of the cDNA coding for C4b-binding protein, a regulatory protein of the classical pathway of the human complement system.
3378624 1988 Derivation of the sequence of the signal peptide in human C4b-binding protein and interspecies cross-hybridisation of the C4bp cDNA sequence.
3017751 1986 Studies on the structure of the human C4b-binding protein gene.
2590215 1989 Molecular cloning of the cDNA coding for proline-rich protein (PRP): identity of PRP as C4b-binding protein.
2352933 1990 Human genes for the alpha and beta chains of complement C4b-binding protein are closely linked in a head-to-tail arrangement.
2237642 1990 Genes for C4b-binding protein alpha- and beta-chains (C4BPA and C4BPB) are located on chromosome 1, band 1q32, in humans and on chromosome 13 in rats.
1989602 1991 Genomic organization of the alpha chain of the human C4b-binding protein gene.
1833851 1991 Protein S and C4b-binding protein: components involved in the regulation of the protein C anticoagulant system.