Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

 Compartment GO Term (2)

AA Sequence

MSAAASPASERGWKSEKLDEAQALARSCAARRPDFQPCDGLSICATHSHGKCFKLHWCCHLGWCHCKYMY      1 - 70
QPMTPVEQLPSTEIPARPREPTNTIQISVSLTEHFLKFASVFQPPLPPDSPRYCMISDLFIDNYQVKCIN     71 - 140
GKMCYVQKQPAPHSHRMSPEEVSAHDALISKESNTPKIDHCSSPSSSEDSGINAIGAHYVESCDEDTEEG    141 - 210
AELSSEEDYSPESSWEPDECTLLSPSQSDLEVIETIETTV                                  211 - 250
//

Text Mined References (5)

PMID Year Title