Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.03
PubTator Score 0.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
lung carcinoma 1.100 5.2e-11
posterior fossa group B ependymoma 1.500 1.4e-05
sonic hedgehog group medulloblastoma 1.100 7.9e-03

Gene RIF (1)

AA Sequence

MIKRKIWCNLCIDLVAFTSEIFKGAVFQSLDGIVVSANCKLRKIFTLKSKPQDTADKDAVYGVPFSTDEP      1 - 70
TDIIPRSCQLMTDVPHVTQLLNMTKLRQTEIKFGGHPLRSAESDQFINRGTSITRNSKNQDVCHIAFGSK     71 - 140
VLGPPPLSGRRNNMKISSETVRSVGSKNNRSCQPSTVEKCVNGTEMSALLIPESEEQGNKENIHQIKQTV    141 - 210
PIHAANLHIMHPHPPQEPSADKNNNRRRLRLKSTSRERTETPSGSSSGNNRIEDKASTILTTVSQQGAEL    211 - 280
LNSGTLGPQSPDQSDEWIFPENADHISYLASSRQSLLLGDDSCNPSHLWLEASKESEHDQQAEESQSVPK    281 - 350
DIFTFSSRPRSAPHGKTQTMSPEELSFILDLKEDNSVTSRDTQSEDDFYGGDSSEEGNHSIQGSRGPTTG    351 - 420
PSELTQLTLESLLGKAAKRTSKEYLRSAYTEAGATESQDSSMEQIDRNNFEMSLLPTTCLSPTGRRCGSC    421 - 490
QKTPEPVIKAKDLSAQQVPASLNKTSLKEISGERLSSIPEASEYDWRNYQPSQMSESELQMLASLRWQQN    491 - 560
EELEDAGTSHGLSASQVDNCNVSISTSSDDTTTWNSCLPPPVNQGRHYQKEMNPPSPSNPRDWLNMLSPP    561 - 630
IVPPSQQPAEQRPDSCESLSVQGEEDLSVEEDEEVLTLLYDPCLNCYFDPQTGKYYELV               631 - 689
//

Text Mined References (5)

PMID Year Title