Property Summary

NCBI Gene PubMed Count 6
PubMed Score 11.42
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

AA Sequence

MDLAQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCKLWMII      1 - 70
TSIFLGVITVIIIGLCLAAVTYVDEDENEILELSSNKTFFIMLKIPEECVAEEELPHLLTERLTDVYSTS     71 - 140
PSLGRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKYMMSEELVLGILLQDFRDQNIPGCESLGLDP    141 - 210
TSLLLYE                                                                   211 - 217
//

Text Mined References (7)

PMID Year Title