Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.27
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis and treatment for 6 months 409 1.6e-05
ovarian cancer 8520 3.2e-04
primary Sjogren syndrome 735 2.4e-03
sarcoidosis 370 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
ovarian cancer 1.300 3.2e-04
primary Sjogren syndrome 1.200 2.4e-03
sarcoidosis 1.200 2.2e-02
tuberculosis and treatment for 6 months 1.100 1.6e-05

AA Sequence

MEMSGLSFSEMEGCRNLLGLLDNDEIMALCDTVTNRLVQPQDRQDAVHAILAYSQSAEELLRRRKVHREV      1 - 70
IFKYLATQGIVIPPATEKHNLIQHAKDYWQKQPQLKLKETPEPVTKTEDIHLFQQQVKEDKKAEKVDFRR     71 - 140
LGEEFCHWFFGLLNSQNPFLGPPQDEWGPQHFWHDVKLRFYYNTSEQNVMDYHGAEIVSLRLLSLVKEEF    141 - 210
LFLSPNLDSHGLKCASSPHGLVMVGVAGTVHRGNTCLGIFEQIFGLIRCPFVENTWKIKFINLKIMGESS    211 - 280
LAPGTLPKPSVKFEQSDLEAFYNVITVCGTNEVRHNVKQASDSGTGDQV                         281 - 329
//

Text Mined References (8)

PMID Year Title