Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.27
PubTator Score 0.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -1.400 2.9e-02
adult high grade glioma -1.900 8.3e-04
astrocytic glioma -2.600 1.4e-02
Astrocytoma, Pilocytic -1.100 2.5e-06
atypical teratoid / rhabdoid tumor -1.100 3.6e-05
breast carcinoma 1.400 7.6e-05
ductal carcinoma in situ 2.500 5.9e-04
ependymoma -2.000 8.0e-03
esophageal adenocarcinoma -1.500 3.3e-02
glioblastoma -1.200 3.0e-07
interstitial cystitis -1.500 6.4e-04
invasive ductal carcinoma 2.500 1.1e-03
lung cancer 1.600 5.8e-03
lung carcinoma 3.200 2.2e-35
malignant mesothelioma -1.800 7.5e-07
medulloblastoma, large-cell -1.100 3.2e-05
oligodendroglioma -2.200 4.8e-02
ovarian cancer -1.800 1.0e-05
subependymal giant cell astrocytoma -1.119 3.1e-02
ulcerative colitis 1.100 1.6e-03

Gene RIF (1)

AA Sequence

MTSLFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKRNLSLLKDIEAAEKSLQT      1 - 70
RIHPLPRPEVVSLETRYWASVEEYIPKWEQFLLGRAPYPFAVENQNEAENTIQNEAQR                 71 - 128
//

Text Mined References (7)

PMID Year Title