Property Summary

NCBI Gene PubMed Count 522
PubMed Score 3446.07
PubTator Score 4193.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
lung carcinoma 2843 1.0e-40
periodontitis 293 1.5e-30
malignant mesothelioma 3232 1.9e-09
Duchenne muscular dystrophy 601 8.5e-09
Astrocytoma, Pilocytic 3081 3.9e-08
limb girdle muscular dystrophy 2A 213 4.9e-07
ovarian cancer 8520 2.2e-06
non-small cell lung cancer 2890 4.1e-06
lung cancer 4740 9.8e-06
ulcerative colitis 1819 4.0e-05
medulloblastoma, large-cell 6241 4.3e-05
juvenile dermatomyositis 1187 4.7e-05
acute quadriplegic myopathy 1158 5.3e-05
tuberculosis 2010 1.6e-04
intraductal papillary-mucinous adenoma (IPMA) 2955 2.1e-03
cystic fibrosis 1696 2.5e-03
atypical teratoid / rhabdoid tumor 5112 2.9e-03
invasive ductal carcinoma 2951 3.5e-03
primary pancreatic ductal adenocarcinoma 1109 4.0e-03
colon cancer 1478 4.3e-03
gastric carcinoma 807 4.6e-03
glioblastoma 5792 4.9e-03
intraductal papillary-mucinous carcinoma (IPMC) 2989 5.4e-03
subependymal giant cell astrocytoma 2287 5.9e-03
chronic kidney disease 90 6.6e-03
psoriasis 6694 7.0e-03
Becker muscular dystrophy 191 8.0e-03
astrocytic glioma 2597 8.3e-03
Down syndrome 499 8.4e-03
primary Sjogren syndrome 735 8.9e-03
head and neck cancer and chronic obstructive pulmonary disease 239 1.0e-02
adrenocortical carcinoma 1428 1.2e-02
group 3 medulloblastoma 4104 1.4e-02
dermatomyositis 966 1.4e-02
diabetes mellitus 1728 1.7e-02
posterior fossa group A ependymoma 468 1.7e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 510 2.3e-02
Gaucher disease type 3 67 3.5e-02
non diabetic and post-ischemic heart failure 200 4.2e-02
aldosterone-producing adenoma 665 4.8e-02
Disease Target Count Z-score Confidence
Macular degeneration 65 0.0 3.0
Disease Target Count Z-score Confidence
Hemolytic-Uremic Syndrome 30 0.0 4.0

Expression

  Differential Expression (40)

Disease log2 FC p
acute quadriplegic myopathy 1.586 5.3e-05
adrenocortical carcinoma -2.666 1.2e-02
aldosterone-producing adenoma -1.893 4.8e-02
astrocytic glioma 1.800 8.3e-03
Astrocytoma, Pilocytic 1.700 3.9e-08
atypical teratoid / rhabdoid tumor -1.900 2.9e-03
autosomal dominant Emery-Dreifuss muscul... 1.112 2.3e-02
Becker muscular dystrophy 1.046 8.0e-03
chronic kidney disease 2.300 6.6e-03
colon cancer -2.300 4.3e-03
cystic fibrosis 1.343 2.5e-03
dermatomyositis 1.200 1.4e-02
diabetes mellitus -1.400 1.7e-02
Down syndrome 1.400 8.4e-03
Duchenne muscular dystrophy 2.153 8.5e-09
gastric carcinoma 2.900 4.6e-03
Gaucher disease type 3 -1.700 3.5e-02
glioblastoma 2.000 4.9e-03
group 3 medulloblastoma -1.900 1.4e-02
head and neck cancer and chronic obstruc... 1.300 1.0e-02
intraductal papillary-mucinous adenoma (... -2.900 2.1e-03
intraductal papillary-mucinous carcinoma... -3.100 5.4e-03
invasive ductal carcinoma -1.500 3.5e-03
juvenile dermatomyositis 1.068 4.7e-05
limb girdle muscular dystrophy 2A 1.732 4.9e-07
lung cancer -3.800 9.8e-06
lung carcinoma -4.400 1.0e-40
malignant mesothelioma -5.300 1.9e-09
medulloblastoma, large-cell -3.200 4.3e-05
non diabetic and post-ischemic heart fai... -1.100 4.2e-02
non-small cell lung cancer -1.286 4.1e-06
ovarian cancer -3.100 2.2e-06
periodontitis 1.200 1.5e-30
posterior fossa group A ependymoma 1.100 1.7e-02
primary pancreatic ductal adenocarcinoma 1.067 4.0e-03
primary Sjogren syndrome 2.200 8.9e-03
psoriasis -1.100 7.0e-03
subependymal giant cell astrocytoma 2.373 5.9e-03
tuberculosis -1.200 1.6e-04
ulcerative colitis 2.400 4.0e-05

 CSPA Cell Line (4)

Protein-protein Interaction (1)

PDB (43)

Gene RIF (443)

AA Sequence

MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLS      1 - 70
SEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYT     71 - 140
PGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYY    141 - 210
ENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQ    211 - 280
RISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVT    281 - 350
SPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPL    351 - 420
SITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYY    421 - 490
TYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCV    491 - 560
GSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDKGVFVLNKKNKLTQSKIWDVVEKADIGCTPG    561 - 630
SGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQPAARRRRSVQLTEKRMDKVGKYPKELRKCCEDGMRE    631 - 700
NPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLARSNLDEDIIAEENIVSRSEFPES    701 - 770
WLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVV    771 - 840
RNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEV    841 - 910
EVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTESETRI    911 - 980
LLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIK    981 - 1050
KGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQE   1051 - 1120
DAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVA   1121 - 1190
IAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQR   1191 - 1260
YYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGF   1261 - 1330
TVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATM   1331 - 1400
SILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVE   1401 - 1470
LIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPG   1471 - 1540
VDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSD   1541 - 1610
FWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN                    1611 - 1663
//

Text Mined References (537)

PMID Year Title