Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.57
PubTator Score 1.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell -1.300 2.5e-03
intraductal papillary-mucinous carcinoma... -1.400 2.5e-03
intraductal papillary-mucinous neoplasm ... -1.400 1.1e-03
Breast cancer 3.100 2.9e-02
ovarian cancer -1.300 9.7e-05
pituitary cancer 1.200 1.0e-04

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20205591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDIPLRTNLPPPFRNYKYDALKIIHQA      1 - 70
HKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSW                   71 - 126
//

Text Mined References (7)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20205591 2010 Host determinants of HIV-1 control in African Americans.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.