Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

AA Sequence

MEEKEDKHQQHKIEDAAITYVSENEEIKHEEKPGKSIHHSKSHVGRGRIYYAKFINTNARTYNEPFPYID      1 - 70
PKKGPEIQGDWWSHGKALEPVFLPPYDSKSTQRSDFQKPSCPLVLPVKHSKMQKPSCGIVPLASPGTSAE     71 - 140
LQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKPGSRPTVPKGAEVLLNTPGSRSSEQSKKTEK    141 - 210
GNSAESRMISPGLCQQNSQELLEPKTHLSETDVRQAAKACPSTPESREKTSGATQTTVGDALFTRHKPLN    211 - 280
PPIKKSE                                                                   281 - 287
//

Text Mined References (4)

PMID Year Title