Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.02
PubTator Score 0.02

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MIIDSSRIPSFTQLHSTMTRAPLLLLCVALVLLGHVNGATVRNEDKWKPLNNPRNRDLFFRRLQAYFKGR      1 - 70
GLDLGTFPNPFPTNENPRPLSFQSELTASASADYEEQKNSFHNYLKG                            71 - 117
//

Text Mined References (3)

PMID Year Title