Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ependymoma 4679 4.8e-08

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma 1.500 4.8e-08

 Compartment GO Term (0)

AA Sequence

MGSHPTPGLQRTTSAGYRLPPTRPPASVSPAARGGPMASRGLAGGCQAPQALKAQRVAQGAACDGVQQDQ      1 - 70
LWRELLEAERRGQQRWIQNWSFLKDYDPMGNKKEPEKLPDHVPLFSDTVPSSTNQVVGSRLDTPLGQTLI     71 - 140
RMDFFFTEGARKKKLEDQMQPI                                                    141 - 162
//

Text Mined References (5)

PMID Year Title