Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96LS8
Symbols

Gene

 Compartment GO Term (0)

Protein-protein Interaction (8)

AA Sequence

MESRPSGRQHASEGDGDQSPTQCAGMRSSGRSDQPYVLKGNPLLLRVRCYSGCASGSGRQLQLSVFQDLN      1 - 70
QFSHCRVWRSPALIVKGEPPWCSQQDTQSPFQTGTPLERPCFRMKLSGWELTKNAQRALGSKLQHILSLD     71 - 140
STQACGAGGPTILRPPRAP                                                       141 - 159
//

Text Mined References (4)

PMID Year Title