Property Summary

NCBI Gene PubMed Count 38
PubMed Score 52.02
PubTator Score 40.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical adenoma -1.398 2.2e-02
adrenocortical carcinoma -2.774 1.0e-12
Astrocytoma, Pilocytic 2.000 1.6e-04
atypical teratoid / rhabdoid tumor -1.500 2.5e-02
Breast cancer -4.800 2.9e-49
breast carcinoma -3.400 5.7e-45
chronic rhinosinusitis -1.866 1.4e-02
ductal carcinoma in situ -2.800 5.2e-04
ependymoma 2.800 7.7e-09
intraductal papillary-mucinous adenoma (... -3.800 1.5e-05
intraductal papillary-mucinous carcinoma... -4.400 4.6e-06
intraductal papillary-mucinous neoplasm ... -4.100 4.1e-04
invasive ductal carcinoma -1.995 3.3e-03
lung adenocarcinoma -1.200 2.3e-08
lung carcinoma -1.300 6.9e-07
medulloblastoma, large-cell -1.700 6.4e-03
nasopharyngeal carcinoma -2.300 4.2e-06
non-small cell lung cancer -3.700 1.6e-26
ovarian cancer -3.600 6.9e-11
psoriasis -1.500 2.5e-06

Gene RIF (30)

AA Sequence

MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKEFLGSLKRQKR      1 - 70
QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHG     71 - 140
ASVNYDDY                                                                  141 - 148
//

Text Mined References (38)

PMID Year Title