Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.07
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.9e-07
breast carcinoma 1638 4.6e-03
fibroadenoma 559 3.5e-02

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma -1.300 4.6e-03
fibroadenoma -1.900 3.5e-02
osteosarcoma 1.800 1.9e-07

AA Sequence

MRKTNMWFLERLRGSGENGAARGVGSEAGDKASKGPLYSNVLTPDKIPDFFIPPKLPSGPAEGEGQAALG      1 - 70
PSTSEQNLASAAPRQTPRSPRLPAKLAAESKSLLKAATRHVIQIESAEDWLSEEATDADPQAQGAMSLPS     71 - 140
VPKAQTSYGFAMLAESPHTRRKESLFHSEHGALAQVGSPGAGRRRAAAKANGGDGGPREAGGALMSPGRY    141 - 210
FSGGESDTGSSAESSPFGSPLLSRSVSLLKGFAQDSQAKVSQLRHSVGRHGSLSADDSTPDASPGSRRRL    211 - 280
TRRAPPEPGPESGQARGEHTVHVGPRGSVRLLAEYEAGQARLRVHLLAAEGLYDRLCDARSINCCVGLCL    281 - 350
VPGKLQKQRSTIVKNSRRPVFNEDFFFDGLGPASVRKLALRIKVVNKGSSLKRDTLLGEKELPLTSLLPF    351 - 420
L//

Text Mined References (5)

PMID Year Title