Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.55
PubTator Score 1.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.800 3.8e-07
psoriasis -1.600 3.7e-04
osteosarcoma -1.931 3.8e-07
ependymoma -1.300 2.0e-16
glioblastoma -1.100 8.3e-10
tuberculosis and treatment for 6 months 1.300 4.2e-05
adult high grade glioma -1.100 5.6e-05
atypical teratoid/rhabdoid tumor -1.200 6.6e-09
pilocytic astrocytoma -1.100 3.6e-07
sonic hedgehog group medulloblastoma -1.100 1.5e-05

Gene RIF (1)

PMID Text
24012759 Paper describes the tissue distribution, interaction partners and pathway where this protein functions. This paper shows that C2CD2L (TMEM24) interacts with insulin and plays a role in Glucose stimulated insulin secretion in pancreatic islets. Also, at protein level shows enrichment for expression in pancreatic islets and brain.

AA Sequence

MDPGWGQRDVGWAALLILFAASLLTVFAWLLQYARGLWLARARGDRGPGPALAGEPAGSLRELGVWRSLL      1 - 70
RLRATRAGAAEEPGVRGLLASLFAFKSFRENWQRAWVRALNEQACRNGSSIQIAFEEVPQLPPRASISHV     71 - 140
TCVDQSEHTMVLRCQLSAEEVRFPVSVTQQSPAAVSMETYHVTLTLPPTQLEVNLEEIPGEGLLISWAFT    141 - 210
DRPDLSLTVLPKLQARERGEEQVELSTIEELIKDAIVSTQPAMMVNLRACSAPGGLVPSEKPPMMPQAQP    211 - 280
AIPRPNRLFLRQLRASHLGNELEGTEELCCVAELDNPMQQKWTKPARAGSEVEWTEDLALDLGPQSRELT    281 - 350
LKVLRSSSCGDTELLGQATLPVGSPSRPLSRRQLCPLTPGPGKALGPAATMAVELHYEEGSPRNLGTPTS    351 - 420
STPRPSITPTKKIELDRTIMPDGTIVTTVTTVQSRPRIDGKLDSPSRSPSKVEVTEKTTTVLSESSGPSN    421 - 490
TSHSSSRDSHLSNGLDPVAETAIRQLTEPSGRVAKKTPTKRSTLIISGVSKVPIAQDELALSLGYAASLE    491 - 560
ASVQDDAGTSGGPSSPPSDPPAMSPGPLDALSSPTSVQEADETTRSDISERPSVDDIESETGSTGALETR    561 - 630
SLKDHKVSFLRSGTKLIFRRRPRQKEAGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANG    631 - 700
NPSPQL                                                                    701 - 706
//

Text Mined References (12)

PMID Year Title
24012759 2013 Insulin biosynthetic interaction network component, TMEM24, facilitates insulin reserve pool release.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16368544 2006 New insights into potential functions for the protein 4.1 superfamily of proteins in kidney epithelium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15289880 2004 Identification and characterization of TMEM24 family genes in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
9179496 1997 Construction and characterization of human brain cDNA libraries suitable for analysis of cDNA clones encoding relatively large proteins.